DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Recognition of the centromere-specific histone Cse4 by the chaperone Scm3. Recognition of the centromere-specific histone Cse4 by the chaperone Scm3. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Cho US., Harrison SC. Only protein-protein interactions ecolx Escherichia coli pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Cho US., Harrison SC. DIP original experiment: DIP-253698X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Recognition of the centromere-specific histone Cse4 by the chaperone Scm3. Recognition of the centromere-specific histone Cse4 by the chaperone Scm3. Recognition of the centromere-specific histone Cse4 by the chaperone Scm3. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Cho US., Harrison SC. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Cho US., Harrison SC. DIP original experiment: DIP-253696X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Recognition of the centromere-specific histone Cse4 by the chaperone Scm3. Recognition of the centromere-specific histone Cse4 by the chaperone Scm3. Recognition of the centromere-specific histone Cse4 by the chaperone Scm3. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Cho US., Harrison SC. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Cho US., Harrison SC. DIP original experiment: DIP-253694X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Recognition of the centromere-specific histone Cse4 by the chaperone Scm3. Recognition of the centromere-specific histone Cse4 by the chaperone Scm3. Recognition of the centromere-specific histone Cse4 by the chaperone Scm3. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Cho US., Harrison SC. Only protein-protein interactions in vitro In vitro solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Cho US., Harrison SC. DIP original experiment: DIP-253695X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Recognition of the centromere-specific histone Cse4 by the chaperone Scm3. Recognition of the centromere-specific histone Cse4 by the chaperone Scm3. Recognition of the centromere-specific histone Cse4 by the chaperone Scm3. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Cho US., Harrison SC. Only protein-protein interactions ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Cho US., Harrison SC. DIP original experiment: DIP-253700X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Recognition of the centromere-specific histone Cse4 by the chaperone Scm3. Recognition of the centromere-specific histone Cse4 by the chaperone Scm3. Recognition of the centromere-specific histone Cse4 by the chaperone Scm3. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Cho US., Harrison SC. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Cho US., Harrison SC. DIP original experiment: DIP-253697X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Recognition of the centromere-specific histone Cse4 by the chaperone Scm3. Recognition of the centromere-specific histone Cse4 by the chaperone Scm3. Recognition of the centromere-specific histone Cse4 by the chaperone Scm3. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Cho US., Harrison SC. Only protein-protein interactions ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Cho US., Harrison SC. DIP original experiment: DIP-253699X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Recognition of the centromere-specific histone Cse4 by the chaperone Scm3. cenpa_yeast Histone H3-like centromeric protein CSE4 CSE4 Chromosome segregation protein 4 CENP-A homolog CSL2 YKL262 YKL049C protein protein yeast Saccharomyces cerevisiae Baker's yeast MSSKQQWVSSAIQSDSSGRSLSNVNRLAGDQQSINDRALSLLQRTRATKNLFPRREERRRYESSKSDLDIETDYEDQAGNLEIETENEEEAEMETEVPAPVRTHSYALDRYVRQKRREKQRKQSLKRVEKKYTPSELALYEIRKYQRSTDLLISKIPFARLVKEVTDEFTTKDQDLRWQSMAIMALQEASEAYLVGLLEHTNLLALHAKRITIMKKDMQLARRIRGQFI 0170A10060EEC309 0170A10060EEC309 q6cmu6_klula Histone H4 KLLA0_E08647g KLLA0_E17601g protein protein klula Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) Yeast Candida sphaerica MSGRGKGGKGLGKGGAKRHRKILRDNIQGITKPAIRRLARRGGVKRISGLIYEEVRNVLKTFLESVIRDAVTYTEHAKRKTVTSLDVVYALKRQGRTLYGFGG DIP protein Q6CMU6 original sequence version: 61 scm3_yeast Protein SCM3 Suppressor of chromosome missegregation protein 3 SCM3 YDL139C D2155 protein protein yeast Saccharomyces cerevisiae Baker's yeast MKTNKKISKRRSLKNLHGALKGLLKESGKKSESKIRKHSDCNPVHRVYPPNIEKRKTKKDDGISRPIAERNGHVYIMSKENHIIPKLTDDEVMERHKLADENMRKVWSNIISKYESIEEQGDLVDLKTGEIVEDNGHIKTLTANNSTKDKRTKYTSVLRDIIDISDEEDGDKNDEYTLWANDSEASDSEVDADNDTEEEKDEKLIDADFKKYEAKLSKRILRD D7668117BCC7FF12 D7668117BCC7FF12 h4_yeast Histone H4 N2752 YBR0122 YBR009C YNL030W HHF1 HHF2 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSGRGKGGKGLGKGGAKRHRKILRDNIQGITKPAIRRLARRGGVKRISGLIYEEVRAVLKSFLESVIRDSVTYTEHAKRKTVTSLDVVYALKRQGRTLYGFGG 69B7D1F89E62DE41 69B7D1F89E62DE41 q6cl77_klula KLLA0_F05115g protein protein klula Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) Yeast Candida sphaerica MIKRPSNSKKKANLRRLTGALRDLLGEEEPKKEENLKQITRDGVVYIMSKENRLIPKLSDEEVMERHKKADENMKRVWSQIIQKYESIDNQGDVIDLQTGEVIEDNGHLRNLSNEKSVLHSSLPDGGSVSYKSVLNDIMDIKDSSYNSSVWQDHETNDSETGSESESGLEADGLDEGSGSEADNSNEVYMKKLRPNPESN DIP protein Q6CL77 original sequence version: 44 DIP protein Q6CL77 original sequence version: 40 cenpa_klula Histone H3-like centromeric protein CSE4 CSE4 CENP-A homolog Chromosome segregation protein 4 KLLA0C12529g protein protein klula Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) Yeast Candida sphaerica MEQSIRSIDGSRSLSNVGASLIDRESINQRALQLLQRNRRRRLLLNRSEDKARYIQPERSASSQQIHPPEHHISAHERITKARGTRYKPTDLALAEIRKYQRSTDLLISRMPFARLVKEVTDQFTTESEPLRWQSMAIMALQEASEAYLVGLLEHTNLLALHAKRITIMRKDMQLARRIRGQFI DIP protein Q6CTI2 original sequence version: 58 cse4-q6cl77_klula-1 2 12 unspecified role unspecified role unspecified role unspecified role Region 41-115 Region 41-115 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 9 unspecified role unspecified role unspecified role unspecified role Region 22-103 Region 22-103 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 13 unspecified role unspecified role unspecified role unspecified role Region 103-184 Region 103-184 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli physical association physical association sccse4-sch4-1 3 8 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 11 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 10 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association q6cl77_klula-cse4-1 1 12 unspecified role unspecified role bait bait MBP-tag MBP-tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 9 unspecified role unspecified role prey prey ecolx Escherichia coli 13 unspecified role unspecified role prey prey ecolx Escherichia coli association association sccse4-sch4-2 4 8 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 11 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 10 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association cse4-q6cmu6_klula-1 5 9 unspecified role unspecified role unspecified role unspecified role Region 22-103 Region 22-103 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 13 unspecified role unspecified role unspecified role unspecified role Region 103-184 Region 103-184 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction cse4-q6cl77_klula-2 6 12 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 9 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 13 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association cse4-q6cl77_klula-3 7 12 unspecified role unspecified role unspecified role unspecified role Region 41-115 Region 41-115 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 9 unspecified role unspecified role unspecified role unspecified role Region 22-103 Region 22-103 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 13 unspecified role unspecified role unspecified role unspecified role Region 103-184 Region 103-184 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction