DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu A novel protein family mediates Casparian strip formation in the endodermis. A novel protein family mediates Casparian strip formation in the endodermis. Nature 2011 imex curation Roppolo D., De Rybel B., Dénervaud Tendon V., Pfister A., Alassimone J., Vermeer JE., Yamazaki M., Stierhof YD., Beeckman T., Geldner N. Only protein-protein interactions arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Roppolo D., De Rybel B., Dénervaud Tendon V., Pfister A., Alassimone J., Vermeer JE., Yamazaki M., Stierhof YD., Beeckman T., Geldner N. DIP original experiment: DIP-218988X Nature 2011 IMEx A novel protein family mediates Casparian strip formation in the endodermis. A novel protein family mediates Casparian strip formation in the endodermis. A novel protein family mediates Casparian strip formation in the endodermis. Nature 2011 imex curation Roppolo D., De Rybel B., Dénervaud Tendon V., Pfister A., Alassimone J., Vermeer JE., Yamazaki M., Stierhof YD., Beeckman T., Geldner N. Only protein-protein interactions arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Roppolo D., De Rybel B., Dénervaud Tendon V., Pfister A., Alassimone J., Vermeer JE., Yamazaki M., Stierhof YD., Beeckman T., Geldner N. DIP original experiment: DIP-218990X Nature 2011 IMEx A novel protein family mediates Casparian strip formation in the endodermis. A novel protein family mediates Casparian strip formation in the endodermis. A novel protein family mediates Casparian strip formation in the endodermis. Nature 2011 imex curation Roppolo D., De Rybel B., Dénervaud Tendon V., Pfister A., Alassimone J., Vermeer JE., Yamazaki M., Stierhof YD., Beeckman T., Geldner N. Only protein-protein interactions arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Roppolo D., De Rybel B., Dénervaud Tendon V., Pfister A., Alassimone J., Vermeer JE., Yamazaki M., Stierhof YD., Beeckman T., Geldner N. DIP original experiment: DIP-218997X Nature 2011 IMEx A novel protein family mediates Casparian strip formation in the endodermis. A novel protein family mediates Casparian strip formation in the endodermis. A novel protein family mediates Casparian strip formation in the endodermis. Nature 2011 imex curation Roppolo D., De Rybel B., Dénervaud Tendon V., Pfister A., Alassimone J., Vermeer JE., Yamazaki M., Stierhof YD., Beeckman T., Geldner N. Only protein-protein interactions arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Roppolo D., De Rybel B., Dénervaud Tendon V., Pfister A., Alassimone J., Vermeer JE., Yamazaki M., Stierhof YD., Beeckman T., Geldner N. DIP original experiment: DIP-218993X Nature 2011 IMEx A novel protein family mediates Casparian strip formation in the endodermis. A novel protein family mediates Casparian strip formation in the endodermis. A novel protein family mediates Casparian strip formation in the endodermis. Nature 2011 imex curation Roppolo D., De Rybel B., Dénervaud Tendon V., Pfister A., Alassimone J., Vermeer JE., Yamazaki M., Stierhof YD., Beeckman T., Geldner N. Only protein-protein interactions arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress anti tag coip anti tag coimmunoprecipitation anti tag coip de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence Roppolo D., De Rybel B., Dénervaud Tendon V., Pfister A., Alassimone J., Vermeer JE., Yamazaki M., Stierhof YD., Beeckman T., Geldner N. DIP original experiment: DIP-218987X Nature 2011 IMEx A novel protein family mediates Casparian strip formation in the endodermis. A novel protein family mediates Casparian strip formation in the endodermis. A novel protein family mediates Casparian strip formation in the endodermis. Nature 2011 imex curation Roppolo D., De Rybel B., Dénervaud Tendon V., Pfister A., Alassimone J., Vermeer JE., Yamazaki M., Stierhof YD., Beeckman T., Geldner N. Only protein-protein interactions arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Roppolo D., De Rybel B., Dénervaud Tendon V., Pfister A., Alassimone J., Vermeer JE., Yamazaki M., Stierhof YD., Beeckman T., Geldner N. DIP original experiment: DIP-218996X Nature 2011 IMEx A novel protein family mediates Casparian strip formation in the endodermis. A novel protein family mediates Casparian strip formation in the endodermis. A novel protein family mediates Casparian strip formation in the endodermis. Nature 2011 imex curation Roppolo D., De Rybel B., Dénervaud Tendon V., Pfister A., Alassimone J., Vermeer JE., Yamazaki M., Stierhof YD., Beeckman T., Geldner N. Only protein-protein interactions arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Roppolo D., De Rybel B., Dénervaud Tendon V., Pfister A., Alassimone J., Vermeer JE., Yamazaki M., Stierhof YD., Beeckman T., Geldner N. DIP original experiment: DIP-218995X Nature 2011 IMEx A novel protein family mediates Casparian strip formation in the endodermis. A novel protein family mediates Casparian strip formation in the endodermis. A novel protein family mediates Casparian strip formation in the endodermis. Nature 2011 imex curation Roppolo D., De Rybel B., Dénervaud Tendon V., Pfister A., Alassimone J., Vermeer JE., Yamazaki M., Stierhof YD., Beeckman T., Geldner N. Only protein-protein interactions arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Roppolo D., De Rybel B., Dénervaud Tendon V., Pfister A., Alassimone J., Vermeer JE., Yamazaki M., Stierhof YD., Beeckman T., Geldner N. DIP original experiment: DIP-218989X Nature 2011 IMEx A novel protein family mediates Casparian strip formation in the endodermis. A novel protein family mediates Casparian strip formation in the endodermis. A novel protein family mediates Casparian strip formation in the endodermis. Nature 2011 imex curation Roppolo D., De Rybel B., Dénervaud Tendon V., Pfister A., Alassimone J., Vermeer JE., Yamazaki M., Stierhof YD., Beeckman T., Geldner N. Only protein-protein interactions arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Roppolo D., De Rybel B., Dénervaud Tendon V., Pfister A., Alassimone J., Vermeer JE., Yamazaki M., Stierhof YD., Beeckman T., Geldner N. DIP original experiment: DIP-218998X Nature 2011 IMEx A novel protein family mediates Casparian strip formation in the endodermis. A novel protein family mediates Casparian strip formation in the endodermis. A novel protein family mediates Casparian strip formation in the endodermis. Nature 2011 imex curation Roppolo D., De Rybel B., Dénervaud Tendon V., Pfister A., Alassimone J., Vermeer JE., Yamazaki M., Stierhof YD., Beeckman T., Geldner N. Only protein-protein interactions arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Roppolo D., De Rybel B., Dénervaud Tendon V., Pfister A., Alassimone J., Vermeer JE., Yamazaki M., Stierhof YD., Beeckman T., Geldner N. DIP original experiment: DIP-218992X Nature 2011 IMEx A novel protein family mediates Casparian strip formation in the endodermis. A novel protein family mediates Casparian strip formation in the endodermis. A novel protein family mediates Casparian strip formation in the endodermis. Nature 2011 imex curation Roppolo D., De Rybel B., Dénervaud Tendon V., Pfister A., Alassimone J., Vermeer JE., Yamazaki M., Stierhof YD., Beeckman T., Geldner N. Only protein-protein interactions arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Roppolo D., De Rybel B., Dénervaud Tendon V., Pfister A., Alassimone J., Vermeer JE., Yamazaki M., Stierhof YD., Beeckman T., Geldner N. DIP original experiment: DIP-218991X Nature 2011 IMEx A novel protein family mediates Casparian strip formation in the endodermis. A novel protein family mediates Casparian strip formation in the endodermis. A novel protein family mediates Casparian strip formation in the endodermis. Nature 2011 imex curation Roppolo D., De Rybel B., Dénervaud Tendon V., Pfister A., Alassimone J., Vermeer JE., Yamazaki M., Stierhof YD., Beeckman T., Geldner N. Only protein-protein interactions arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Roppolo D., De Rybel B., Dénervaud Tendon V., Pfister A., Alassimone J., Vermeer JE., Yamazaki M., Stierhof YD., Beeckman T., Geldner N. DIP original experiment: DIP-218994X Nature 2011 IMEx A novel protein family mediates Casparian strip formation in the endodermis. casp1_arath Casparian strip membrane protein 1 CASP1 F9C22.3 At2g36100 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAKESTTIDVGEPSTVTKSSSHVVKDAKKKGFVAVASRGGAKRGLAIFDFLLRLAAIAVTIGAASVMYTAEETLPFFTQFLQFQAGYDDLPAFQYFVIAVAVVASYLVLSLPFSIVSIVRPHAVAPRLILLICDTLVVTLNTSAAAAAASITYLAHNGNQSTNWLPICQQFGDFCQNVSTAVVADSIAILFFIVLIIISAIALKRH DIP protein Q9SIH4 original sequence version: 47 E0BCBE459A96C771 casp4_arath Casparian strip membrane protein 4 CASP4 MBL20.8 At5g06200 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MKSDSIAVDVPAESSSVIKGKAPLLGLARDHTGSGGYKRGLSIFDFLLRLAAIVAALAAAATMGTSDETLPFFTQFLQFEASYDDLPTFQFFVVAIAIVAGYLVLSLPFSVVTIVRPLAVAPRLLLLVLDTAALALDTAAASAAAAIVYLAHNGNTNTNWLPICQQFGDFCQKTSGAVVSAFASVTFLAILVVISGVSLKRP DIP protein Q9FFZ7 original sequence version: 42 casp3_arath Casparian strip membrane protein 3 CASP3 F10A12.5 F12K2.5 At2g27370 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDIEKAGSRREEEEPIVQRPKLDKGKGKAHVFAPPMNYNRIMDKHKQEKMSPAGWKRGVAIFDFVLRLIAAITAMAAAAKMATTEETLPFFTQFLQFQADYTDLPTMSSFVIVNSIVGGYLTLSLPFSIVCILRPLAVPPRLFLILCDTVMMGLTLMAASASAAIVYLAHNGNSSSNWLPVCQQFGDFCQGTSGAVVASFIAATLLMFLVILSAFALKRTT DIP protein Q9ZQI2 original sequence version: 49 casp2_arath Casparian strip membrane protein 2 CASP2 F24K9.22 At3g11550 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MKNESTFIDVPAESSSAMKGKAPLIGVARDHTTSGSGGYNRGLAIFDFLLRLAAIVAALAAAATMGTSDETLPFFTQFLQFEASYDDLPTFQFFVIAMALVGGYLVLSLPISVVTILRPLATAPRLLLLVLDTGVLALNTAAASSAAAISYLAHSGNQNTNWLPICQQFGDFCQKSSGAVVSAFVSVVFFTILVVISGVALKRH DIP protein Q9CAX3 original sequence version: 47 casp5_arath Casparian strip membrane protein 5 CASP5 F8M21_180 At5g15290 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MKSGQAEIMETSKGIQKSGLMSRRIAILEFILRIVAFFNTIGSAILMGTTHETLPFFTQFIRFQAEYNDLPALTFFVVANAVVSGYLILSLTLAFVHIVKRKTQNTRILLIILDVAMLGLLTSGASSAAAIVYLAHNGNNKTNWFAICQQFNSFCERISGSLIGSFIAIVLLILLILLSAIALSRRH DIP protein Q9LXF3 original sequence version: 46 casp1-casp3-1 5 15 unspecified role unspecified role prey prey arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress 13 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress physical association physical association casp1-casp1-2 8 13 unspecified role unspecified role prey prey mCherry-tag mCherry-tag fluorescent prot tag fluorescent protein tag fluorescent prot tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress 13 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress physical association physical association casp2-casp1-1 11 16 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress 13 unspecified role unspecified role prey prey mCherry-tag mCherry-tag fluorescent prot tag fluorescent protein tag fluorescent prot tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress physical association physical association casp2-casp4-1 4 14 unspecified role unspecified role prey prey mCherry-tag mCherry-tag fluorescent prot tag fluorescent protein tag fluorescent prot tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress 16 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress physical association physical association casp3-casp4-1 7 14 unspecified role unspecified role prey prey mCherry-tag mCherry-tag fluorescent prot tag fluorescent protein tag fluorescent prot tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress 15 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress physical association physical association casp5-casp3-1 3 15 unspecified role unspecified role prey prey mCherry-tag mCherry-tag fluorescent prot tag fluorescent protein tag fluorescent prot tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress 17 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress physical association physical association casp1-casp3-2 1 15 unspecified role unspecified role prey prey mCherry-tag mCherry-tag fluorescent prot tag fluorescent protein tag fluorescent prot tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress 13 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress physical association physical association casp1-casp4-1 2 14 unspecified role unspecified role prey prey mCherry-tag mCherry-tag fluorescent prot tag fluorescent protein tag fluorescent prot tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress 13 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress physical association physical association casp2-casp3-1 10 15 unspecified role unspecified role prey prey mCherry-tag mCherry-tag fluorescent prot tag fluorescent protein tag fluorescent prot tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress 16 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress physical association physical association casp3-casp3-1 12 15 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress 15 unspecified role unspecified role prey prey mCherry-tag mCherry-tag fluorescent prot tag fluorescent protein tag fluorescent prot tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress physical association physical association casp5-casp1-1 6 17 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress 13 unspecified role unspecified role prey prey mCherry-tag mCherry-tag fluorescent prot tag fluorescent protein tag fluorescent prot tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress physical association physical association casp5-casp4-1 9 14 unspecified role unspecified role prey prey mCherry-tag mCherry-tag fluorescent prot tag fluorescent protein tag fluorescent prot tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress 17 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress physical association physical association