DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Multimeric assembly and biochemical characterization of the Trax-translin endonuclease complex. Multimeric assembly and biochemical characterization of the Trax-translin endonuclease complex. Nature structural & molecular biology 2011 imex curation Tian Y., Simanshu DK., Ascano M., Diaz-Avalos R., Park AY., Juranek SA., Rice WJ., Yin Q., Robinson CV., Tuschl T., Patel DJ. Only protein-protein interactions ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Tian Y., Simanshu DK., Ascano M., Diaz-Avalos R., Park AY., Juranek SA., Rice WJ., Yin Q., Robinson CV., Tuschl T., Patel DJ. DIP original experiment: DIP-218579X Nature structural & molecular biology 2011 IMEx Multimeric assembly and biochemical characterization of the Trax-translin endonuclease complex. Multimeric assembly and biochemical characterization of the Trax-translin endonuclease complex. Multimeric assembly and biochemical characterization of the Trax-translin endonuclease complex. Nature structural & molecular biology 2011 imex curation Tian Y., Simanshu DK., Ascano M., Diaz-Avalos R., Park AY., Juranek SA., Rice WJ., Yin Q., Robinson CV., Tuschl T., Patel DJ. Only protein-protein interactions ecolx Escherichia coli ms of complexes mass spectrometry studies of complexes ms of complexes predetermined predetermined participant predetermined Tian Y., Simanshu DK., Ascano M., Diaz-Avalos R., Park AY., Juranek SA., Rice WJ., Yin Q., Robinson CV., Tuschl T., Patel DJ. DIP original experiment: DIP-218580X Nature structural & molecular biology 2011 IMEx Multimeric assembly and biochemical characterization of the Trax-translin endonuclease complex. Multimeric assembly and biochemical characterization of the Trax-translin endonuclease complex. Multimeric assembly and biochemical characterization of the Trax-translin endonuclease complex. Nature structural & molecular biology 2011 imex curation Tian Y., Simanshu DK., Ascano M., Diaz-Avalos R., Park AY., Juranek SA., Rice WJ., Yin Q., Robinson CV., Tuschl T., Patel DJ. Only protein-protein interactions ecolx Escherichia coli tem transmission electron microscopy tem predetermined predetermined participant predetermined Tian Y., Simanshu DK., Ascano M., Diaz-Avalos R., Park AY., Juranek SA., Rice WJ., Yin Q., Robinson CV., Tuschl T., Patel DJ. DIP original experiment: DIP-218581X Nature structural & molecular biology 2011 IMEx Multimeric assembly and biochemical characterization of the Trax-translin endonuclease complex. Multimeric assembly and biochemical characterization of the Trax-translin endonuclease complex. Multimeric assembly and biochemical characterization of the Trax-translin endonuclease complex. Nature structural & molecular biology 2011 imex curation Tian Y., Simanshu DK., Ascano M., Diaz-Avalos R., Park AY., Juranek SA., Rice WJ., Yin Q., Robinson CV., Tuschl T., Patel DJ. Only protein-protein interactions ecolx Escherichia coli pull down pull down predetermined predetermined participant predetermined Tian Y., Simanshu DK., Ascano M., Diaz-Avalos R., Park AY., Juranek SA., Rice WJ., Yin Q., Robinson CV., Tuschl T., Patel DJ. DIP original experiment: DIP-218576X Nature structural & molecular biology 2011 IMEx Multimeric assembly and biochemical characterization of the Trax-translin endonuclease complex. Multimeric assembly and biochemical characterization of the Trax-translin endonuclease complex. Multimeric assembly and biochemical characterization of the Trax-translin endonuclease complex. Nature structural & molecular biology 2011 imex curation Tian Y., Simanshu DK., Ascano M., Diaz-Avalos R., Park AY., Juranek SA., Rice WJ., Yin Q., Robinson CV., Tuschl T., Patel DJ. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Tian Y., Simanshu DK., Ascano M., Diaz-Avalos R., Park AY., Juranek SA., Rice WJ., Yin Q., Robinson CV., Tuschl T., Patel DJ. DIP original experiment: DIP-218577X Nature structural & molecular biology 2011 IMEx Multimeric assembly and biochemical characterization of the Trax-translin endonuclease complex. Multimeric assembly and biochemical characterization of the Trax-translin endonuclease complex. Multimeric assembly and biochemical characterization of the Trax-translin endonuclease complex. Nature structural & molecular biology 2011 imex curation Tian Y., Simanshu DK., Ascano M., Diaz-Avalos R., Park AY., Juranek SA., Rice WJ., Yin Q., Robinson CV., Tuschl T., Patel DJ. Only protein-protein interactions ecolx Escherichia coli light scattering light scattering predetermined predetermined participant predetermined Tian Y., Simanshu DK., Ascano M., Diaz-Avalos R., Park AY., Juranek SA., Rice WJ., Yin Q., Robinson CV., Tuschl T., Patel DJ. DIP original experiment: DIP-218578X Nature structural & molecular biology 2011 IMEx Multimeric assembly and biochemical characterization of the Trax-translin endonuclease complex. q9vf77_drome Trax Dmel\CG5063 trax Dmel_CG5063 Trax-RB CG5063 TRAX protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MPKNGGAGHRNTAPRKRQIPAAQLDEDSPIVQQFRIYSNELIMKHDRHERIVKLSRDITIESKRIIFLLHSIDSRKQNKEKVLEEARQRLNKLIAVNFRAVALELRDQDVYQFRSSYSPGLQEFIEAYTYMEYLCHEDAEGENETKSVSDWQAIQAVMQYVEESSQPKEEPTEGEDVQAIAQVESPKKFQFFVDPTEYILGLSDLTGELMRRCINSLGSGDTDTCLDTCKALQHFYSGYISLNCQRARELWRKITTMKQSVLKAENVCYNVKVRGGEAAKWGATFDQKPADEVDEGFY This sequence has been withdrawn from Uniprot. BE0B8A6A6A681B89 BE0B8A6A6A681B89 q7jvk6_drome Component 3 of promoter of RISC trsn Dmel_CG11761 translin CG11761 Dmel\CG11761 TB-RBP Translin protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MSNFVNLDIFSNYQKYIDNEQEVRENIRIVVREIEHLSKEAQIKLQIIHSDLSQISAACGLARKQVELCAQKYQKLAELVPAGQYYRYSDHWTFITQRLIFIIALVIYLEAGFLVTRETVAEMLGLKISQSEGFHLDVEDYLLGILQLASELSRFATNSVTMGDYERPLNISHFIGDLNTGFRLLNLKNDGLRKRFDALKYDVKKIEEVVYDVSIRGLSSKEKDQQEEPAVPATE DIP protein Q7JVK6 original sequence version: 44 4BE4BE3DFAAE4281 trax-trsn-3 2 7 unspecified role unspecified role unspecified role unspecified role Region 30-298 Region 30-298 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 8 unspecified role unspecified role unspecified role unspecified role Region 1-217 Region 1-217 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction trsn-trax-1 4 7 unspecified role unspecified role prey prey Region 30-298 Region 30-298 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 8 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Region 1-217 Region 1-217 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli physical association physical association trax-trsn-4 6 7 unspecified role unspecified role unspecified role unspecified role Region 30-298 Region 30-298 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 8 unspecified role unspecified role unspecified role unspecified role Region 1-217 Region 1-217 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction trax-trsn-5 3 7 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 8 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction trax-trsn-6 5 7 unspecified role unspecified role unspecified role unspecified role Region 30-298 Region 30-298 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 8 unspecified role unspecified role unspecified role unspecified role Region 1-217 Region 1-217 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction trax-trsn-7 1 7 unspecified role unspecified role unspecified role unspecified role Region 30-298 Region 30-298 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 8 unspecified role unspecified role unspecified role unspecified role Region 1-217 Region 1-217 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction