DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Structural context for mobilization of a human tRNA synthetase from its cytoplasmic complex. Structural context for mobilization of a human tRNA synthetase from its cytoplasmic complex. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Fang P., Zhang HM., Shapiro R., Marshall AG., Schimmel P., Yang XL., Guo M. Only protein-protein interactions ecolx Escherichia coli saxs x ray scattering saxs predetermined predetermined participant predetermined Fang P., Zhang HM., Shapiro R., Marshall AG., Schimmel P., Yang XL., Guo M. DIP original experiment: DIP-253662X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Structural context for mobilization of a human tRNA synthetase from its cytoplasmic complex. Structural context for mobilization of a human tRNA synthetase from its cytoplasmic complex. Structural context for mobilization of a human tRNA synthetase from its cytoplasmic complex. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Fang P., Zhang HM., Shapiro R., Marshall AG., Schimmel P., Yang XL., Guo M. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Fang P., Zhang HM., Shapiro R., Marshall AG., Schimmel P., Yang XL., Guo M. DIP original experiment: DIP-253661X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Structural context for mobilization of a human tRNA synthetase from its cytoplasmic complex. Structural context for mobilization of a human tRNA synthetase from its cytoplasmic complex. Structural context for mobilization of a human tRNA synthetase from its cytoplasmic complex. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Fang P., Zhang HM., Shapiro R., Marshall AG., Schimmel P., Yang XL., Guo M. Only protein-protein interactions ecolx Escherichia coli saxs x ray scattering saxs predetermined predetermined participant predetermined Fang P., Zhang HM., Shapiro R., Marshall AG., Schimmel P., Yang XL., Guo M. DIP original experiment: DIP-253666X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Structural context for mobilization of a human tRNA synthetase from its cytoplasmic complex. Structural context for mobilization of a human tRNA synthetase from its cytoplasmic complex. Structural context for mobilization of a human tRNA synthetase from its cytoplasmic complex. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Fang P., Zhang HM., Shapiro R., Marshall AG., Schimmel P., Yang XL., Guo M. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Fang P., Zhang HM., Shapiro R., Marshall AG., Schimmel P., Yang XL., Guo M. DIP original experiment: DIP-253663X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Structural context for mobilization of a human tRNA synthetase from its cytoplasmic complex. Structural context for mobilization of a human tRNA synthetase from its cytoplasmic complex. Structural context for mobilization of a human tRNA synthetase from its cytoplasmic complex. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Fang P., Zhang HM., Shapiro R., Marshall AG., Schimmel P., Yang XL., Guo M. Only protein-protein interactions ecolx Escherichia coli pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Fang P., Zhang HM., Shapiro R., Marshall AG., Schimmel P., Yang XL., Guo M. DIP original experiment: DIP-253664X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Structural context for mobilization of a human tRNA synthetase from its cytoplasmic complex. Structural context for mobilization of a human tRNA synthetase from its cytoplasmic complex. Structural context for mobilization of a human tRNA synthetase from its cytoplasmic complex. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Fang P., Zhang HM., Shapiro R., Marshall AG., Schimmel P., Yang XL., Guo M. Only protein-protein interactions ecolx Escherichia coli pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Fang P., Zhang HM., Shapiro R., Marshall AG., Schimmel P., Yang XL., Guo M. DIP original experiment: DIP-253665X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Structural context for mobilization of a human tRNA synthetase from its cytoplasmic complex. aimp2_human Aminoacyl tRNA synthase complex-interacting multifunctional protein 2 Protein JTV-1 AIMP2 PRO0992 JTV1 Multisynthase complex auxiliary component p38 protein protein human Homo sapiens Human MPMYQVKPYHGGGAPLRVELPTCMYRLPNVHGRSYGPAPGAGHVQEESNLSLQALESRQDDILKRLYELKAAVDGLSKMIQTPDADLDVTNIIQADEPTTLTTNALDLNSVLGKDYGALKDIVINANPASPPLSLLVLHRLLCEHFRVLSTVHTHSSVKSVPENLLKCFGEQNKKQPRQDYQLGFTLIWKNVPKTQMKFSIQTMCPIEGEGNIARFLFSLFGQKHNAVNATLIDSWVDIAIFQLKEGSSKEKAAVFRSMNSALGKSPWLAGNELTVADVVLWSVLQQIGGCSVTVPANVQRWMRSCENLAPFNTALKLLK DIP protein Q13155 original sequence version: 112 DIP protein Q13155 original sequence version: 115 DIP protein Q13155 original sequence version: 88 F253726B63C12BAB syk_human Lysine--tRNA ligase KARS1 KARS KIAA0070 Lysyl-tRNA synthetase protein protein human Homo sapiens Human MAAVQAAEVKVDGSEPKLSKNELKRRLKAEKKVAEKEAKQKELSEKQLSQATAAATNHTTDNGVGPEEESVDPNQYYKIRSQAIHQLKVNGEDPYPHKFHVDISLTDFIQKYSHLQPGDHLTDITLKVAGRIHAKRASGGKLIFYDLRGEGVKLQVMANSRNYKSEEEFIHINNKLRRGDIIGVQGNPGKTKKGELSIIPYEITLLSPCLHMLPHLHFGLKDKETRYRQRYLDLILNDFVRQKFIIRSKIITYIRSFLDELGFLEIETPMMNIIPGGAVAKPFITYHNELDMNLYMRIAPELYHKMLVVGGIDRVYEIGRQFRNEGIDLTHNPEFTTCEFYMAYADYHDLMEITEKMVSGMVKHITGSYKVTYHPDGPEGQAYDVDFTPPFRRINMVEELEKALGMKLPETNLFETEETRKILDDICVAKAVECPPPRTTARLLDKLVGEFLEVTCINPTFICDHPQIMSPLAKWHRSKEGLTERFELFVMKKEICNAYTELNDPMRQRQLFEEQAKAKAAGDDEAMFIDENFCTALEYGLPPTAGWGMGIDRVAMFLTDSNNIKEVLLFPAMKPEDKKENVATTDTLESTTVGTSV DIP protein Q15046 original sequence version: 69 DIP protein Q15046 original sequence version: 116 DIP protein Q15046-1 original sequence version: 124 DIP protein Q15046-1 original sequence version: 129 DIP protein Q15046 original sequence version: 129 E7770953332D905D kars-4 2 8 unspecified role unspecified role unspecified role unspecified role Region 70-584 Region 70-584 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction kars-aimp2-1 5 7 unspecified role unspecified role prey prey Region 1-48 Region 1-48 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain StrepII-tag StrepII-tag strep ii tag strep ii tag Strep (II) Strep II Strep (II) Strep II c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecolx Escherichia coli 8 unspecified role unspecified role bait bait Region 70-584 Region 70-584 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecolx Escherichia coli direct interaction direct interaction aimp2-kars-7 3 7 unspecified role unspecified role unspecified role unspecified role Region 1-48 Region 1-48 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 8 unspecified role unspecified role unspecified role unspecified role Region 70-584 Region 70-584 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction kars-5 1 8 unspecified role unspecified role unspecified role unspecified role Region 70-584 Region 70-584 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction aimp2-kars-8 4 7 unspecified role unspecified role unspecified role unspecified role Region 1-48 Region 1-48 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 8 unspecified role unspecified role unspecified role unspecified role Region 70-584 Region 70-584 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction aimp2-kars-9 6 7 unspecified role unspecified role bait bait Region 1-48 Region 1-48 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain StrepII-tag StrepII-tag strep ii tag strep ii tag Strep (II) Strep II Strep (II) Strep II c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecolx Escherichia coli 8 unspecified role unspecified role prey prey Region 70-584 Region 70-584 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecolx Escherichia coli direct interaction direct interaction