DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu The Arabidopsis thaliana Med25 mediator subunit integrates environmental cues to control plant development. The Arabidopsis thaliana Med25 mediator subunit integrates environmental cues to control plant development. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Elfving N., Davoine C., Benlloch R., Blomberg J., Brännström K., Müller D., Nilsson A., Ulfstedt M., Ronne H., Wingsle G., Nilsson O., Björklund S. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Elfving N., Davoine C., Benlloch R., Blomberg J., Brännström K., Müller D., Nilsson A., Ulfstedt M., Ronne H., Wingsle G., Nilsson O., Björklund S. DIP original experiment: DIP-253658X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx The Arabidopsis thaliana Med25 mediator subunit integrates environmental cues to control plant development. The Arabidopsis thaliana Med25 mediator subunit integrates environmental cues to control plant development. The Arabidopsis thaliana Med25 mediator subunit integrates environmental cues to control plant development. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Elfving N., Davoine C., Benlloch R., Blomberg J., Brännström K., Müller D., Nilsson A., Ulfstedt M., Ronne H., Wingsle G., Nilsson O., Björklund S. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Elfving N., Davoine C., Benlloch R., Blomberg J., Brännström K., Müller D., Nilsson A., Ulfstedt M., Ronne H., Wingsle G., Nilsson O., Björklund S. DIP original experiment: DIP-253653X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx The Arabidopsis thaliana Med25 mediator subunit integrates environmental cues to control plant development. The Arabidopsis thaliana Med25 mediator subunit integrates environmental cues to control plant development. The Arabidopsis thaliana Med25 mediator subunit integrates environmental cues to control plant development. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Elfving N., Davoine C., Benlloch R., Blomberg J., Brännström K., Müller D., Nilsson A., Ulfstedt M., Ronne H., Wingsle G., Nilsson O., Björklund S. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Elfving N., Davoine C., Benlloch R., Blomberg J., Brännström K., Müller D., Nilsson A., Ulfstedt M., Ronne H., Wingsle G., Nilsson O., Björklund S. DIP original experiment: DIP-253656X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx The Arabidopsis thaliana Med25 mediator subunit integrates environmental cues to control plant development. The Arabidopsis thaliana Med25 mediator subunit integrates environmental cues to control plant development. The Arabidopsis thaliana Med25 mediator subunit integrates environmental cues to control plant development. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Elfving N., Davoine C., Benlloch R., Blomberg J., Brännström K., Müller D., Nilsson A., Ulfstedt M., Ronne H., Wingsle G., Nilsson O., Björklund S. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Elfving N., Davoine C., Benlloch R., Blomberg J., Brännström K., Müller D., Nilsson A., Ulfstedt M., Ronne H., Wingsle G., Nilsson O., Björklund S. DIP original experiment: DIP-253652X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx The Arabidopsis thaliana Med25 mediator subunit integrates environmental cues to control plant development. The Arabidopsis thaliana Med25 mediator subunit integrates environmental cues to control plant development. The Arabidopsis thaliana Med25 mediator subunit integrates environmental cues to control plant development. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Elfving N., Davoine C., Benlloch R., Blomberg J., Brännström K., Müller D., Nilsson A., Ulfstedt M., Ronne H., Wingsle G., Nilsson O., Björklund S. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Elfving N., Davoine C., Benlloch R., Blomberg J., Brännström K., Müller D., Nilsson A., Ulfstedt M., Ronne H., Wingsle G., Nilsson O., Björklund S. DIP original experiment: DIP-253659X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx The Arabidopsis thaliana Med25 mediator subunit integrates environmental cues to control plant development. The Arabidopsis thaliana Med25 mediator subunit integrates environmental cues to control plant development. The Arabidopsis thaliana Med25 mediator subunit integrates environmental cues to control plant development. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Elfving N., Davoine C., Benlloch R., Blomberg J., Brännström K., Müller D., Nilsson A., Ulfstedt M., Ronne H., Wingsle G., Nilsson O., Björklund S. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Elfving N., Davoine C., Benlloch R., Blomberg J., Brännström K., Müller D., Nilsson A., Ulfstedt M., Ronne H., Wingsle G., Nilsson O., Björklund S. DIP original experiment: DIP-253654X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx The Arabidopsis thaliana Med25 mediator subunit integrates environmental cues to control plant development. The Arabidopsis thaliana Med25 mediator subunit integrates environmental cues to control plant development. The Arabidopsis thaliana Med25 mediator subunit integrates environmental cues to control plant development. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Elfving N., Davoine C., Benlloch R., Blomberg J., Brännström K., Müller D., Nilsson A., Ulfstedt M., Ronne H., Wingsle G., Nilsson O., Björklund S. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Elfving N., Davoine C., Benlloch R., Blomberg J., Brännström K., Müller D., Nilsson A., Ulfstedt M., Ronne H., Wingsle G., Nilsson O., Björklund S. DIP original experiment: DIP-253655X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx The Arabidopsis thaliana Med25 mediator subunit integrates environmental cues to control plant development. The Arabidopsis thaliana Med25 mediator subunit integrates environmental cues to control plant development. The Arabidopsis thaliana Med25 mediator subunit integrates environmental cues to control plant development. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Elfving N., Davoine C., Benlloch R., Blomberg J., Brännström K., Müller D., Nilsson A., Ulfstedt M., Ronne H., Wingsle G., Nilsson O., Björklund S. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Elfving N., Davoine C., Benlloch R., Blomberg J., Brännström K., Müller D., Nilsson A., Ulfstedt M., Ronne H., Wingsle G., Nilsson O., Björklund S. DIP original experiment: DIP-253657X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx The Arabidopsis thaliana Med25 mediator subunit integrates environmental cues to control plant development. The Arabidopsis thaliana Med25 mediator subunit integrates environmental cues to control plant development. The Arabidopsis thaliana Med25 mediator subunit integrates environmental cues to control plant development. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Elfving N., Davoine C., Benlloch R., Blomberg J., Brännström K., Müller D., Nilsson A., Ulfstedt M., Ronne H., Wingsle G., Nilsson O., Björklund S. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Elfving N., Davoine C., Benlloch R., Blomberg J., Brännström K., Müller D., Nilsson A., Ulfstedt M., Ronne H., Wingsle G., Nilsson O., Björklund S. DIP original experiment: DIP-253660X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx The Arabidopsis thaliana Med25 mediator subunit integrates environmental cues to control plant development. dre2a_arath Dehydration-responsive element-binding protein 2A DREB2A ERF045 K18I23.22 At5g05410 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAVYDQSGDRNRTQIDTSRKRKSRSRGDGTTVAERLKRWKEYNETVEEVSTKKRKVPAKGSKKGCMKGKGGPENSRCSFRGVRQRIWGKWVAEIREPNRGSRLWLGTFPTAQEAASAYDEAAKAMYGPLARLNFPRSDASEVTSTSSQSEVCTVETPGCVHVKTEDPDCESKPFSGGVEPMYCLENGAEEMKRGVKADKHWLSEFEHNYWSDILKEKEKQKEQGIVETCQQQQQDSLSVADYGWPNDVDQSHLDSSDMFDVDELLRDLNGDDVFAGLNQDRYPGNSVANGSYRPESQQSGFDPLQSLNYGIPPFQLEGKDGNGFFDDLSYLDLEN DIP protein O82132 original sequence version: 97 9742CE579CC7314C q8gun5-2 Protein PHR1-LIKE 1 PHL1 Myb-like transcription factor 1 F3F24.100 At5g29000 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MNNPVPCQSVSGGNSGGYLFPSSSGYCNVSAVLPHGRNLQNQPPVSTVPRDRLAMQDCPLIAQSSLINHHPQEFIDPLHEFFDFSDHVPVQNLQAESSGVRVDSSVELHKKSEWQDWADQLISVDDGSEPNWSELLGDSSSHNPNSEIPTPFLDVPRLDITANQQQQMVSSEDQLSGRNSSSSVATSKQRMRWTPELHEAFVEAVNQLGGSERATPKAVLKLLNNPGLTIYHVKSHLQKYRTARYKPETSEVTGEPQEKKMTSIEDIKSLDMKTSVEITQALRLQMEVQKRLHEQLEIQRSLQLQIEKQGRYLQMMFEKQQKIQDNKSSSSEASPKQCNGSFAEVEVGLETLTGDQNESASASRKRVRED DIP protein Q8GUN5-2 original sequence version: 74 zhd11_arath Zinc-finger homeodomain protein 11 ZHD11 HB29 Transcription factor HB29 ZFHD1 Zinc finger homeodomain transcription factor 1 F24J1.29 At1g69600 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDLSSKPQQQLLNSLPIAGELTVTGEMGVCYKECLKNHAANLGGHALDGCGEFMPSPTATSTDPSSLRCAACGCHRNFHRRDPSENLNFLTAPPISSPSGTESPPSRHVSSPVPCSYYTSAPPHHVILSLSSGFPGPSDQDPTVVRSENSSRGAMRKRTRTKFTPEQKIKMRAFAEKAGWKINGCDEKSVREFCNEVGIERGVLKVWMHNNKYSLLNGKIREIEHGLCLNTHSNDGDGSSSS DIP protein Q9SEZ1 original sequence version: 84 9786B91E121EC5F4 q7xyy2-1 Mediator of RNA polymerase II transcription subunit 25 MED25 MED25_1 PFT1 F2J7.4 At1g25540 Phytochrome and flowering time 1 protein Phytochrome and flowering time regulatory protein 1 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSSEVKQLIVVAEGTAALGPYWQTIVSDYLEKIIRSFCGSELNGERNPVSTVELSLVIFNSHGSYCACLVQRSGWTRDVDIFLHWLSSIQFGGGGFNEVATAEGLAEALMMFSPPSGQAQPSNDLKRHCILITASNPHILPTPVYRPRLQNVERNENGDAQAESRLSDAETVASYFAKCSVSLSVVCPKQLPTIRALYNAGKPNQQSADLSIDTAKNTFYLVLISENFVEACAALSHSATNLPQTQSPVKVDRATVAPSIPVTGQPPAPVSSANGPIQNRQPVSVGPVPTATVKVEPSTVTSMAPVPSFPHIPAVARPATQAIPSIQTSSASPVSQDMVSNAENAPDIKPVVVSGMTPPLRTGPPGGANVNLLNNLSQVRQVMSSAALAGAASSVGQSAVAMHMSNMISTGMATSLPPSQTVFSTGQQGITSMAGSGALMGSAQTGQSPGPNNAFSPQTTSNVASNLGVSQPMQGMNQGSHSGAMMQGGISMNQNMMSGLGQGNVSSGTGGMMPTPGVGQQAQSGIQQLGGSNSSAPNMQLSQPSSGAMQTSQSKYVKVWEGNLSGQRQGQPVLITRLEGYRSASASDSLAANWPPTMQIVRLISQDHMNNKQYVGKADFLVFRAMSQHGFLGQLQDKKLCAVIQLPSQTLLLSVSDKACRLIGMLFPGDMVVFKPQIPNQQQQQQQQLHQQQQQQQQIQQQQQQQQHLQQQQMPQLQQQQQQHQQQQQQQHQLSQLQHHQQQQQQQQQQQQQHQLTQLQHHHQQQQQASPLNQMQQQTSPLNQMQQQTSPLNQMQQQQQPQQMVMGGQAFAQAPGRSQQGGGGGQPNMPGAGFMG DIP protein Q7XYY2-1 original sequence version: 81 DIP protein Q7XYY2-1 original sequence version: 57 phl1_arath Protein PHR1-LIKE 1 PHL1 Myb-like transcription factor 1 F3F24.100 At5g29000 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MTLANDFGYSTAMSSSYSALHTSVEDRYHKLPNSFWVSSGQELMNNPVPCQSVSGGNSGGYLFPSSSGYCNVSAVLPHGRNLQNQPPVSTVPRDRLAMQDCPLIAQSSLINHHPQEFIDPLHEFFDFSDHVPVQNLQAESSGVRVDSSVELHKKSEWQDWADQLISVDDGSEPNWSELLGDSSSHNPNSEIPTPFLDVPRLDITANQQQQMVSSEDQLSGRNSSSSVATSKQRMRWTPELHEAFVEAVNQLGGSERATPKAVLKLLNNPGLTIYHVKSHLQKYRTARYKPETSEVTGEPQEKKMTSIEDIKSLDMKTSVEITQALRLQMEVQKRLHEQLEIQRSLQLQIEKQGRYLQMMFEKQQKIQDNKSSSSEASPKQCNGSFAEVEVGLETLTGDQNESASASRKRVRED DIP protein Q8GUN5 original sequence version: 74 med25-dreb2a-1 4 10 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 13 unspecified role unspecified role bait bait Region 551-680 Region 551-680 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction med25-phl1-1 8 11 unspecified role unspecified role prey prey Region 103-309 Region 103-309 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 13 unspecified role unspecified role bait bait Region 551-680 Region 551-680 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction med25-zhd11-1 5 12 unspecified role unspecified role prey prey ecolx Escherichia coli 13 unspecified role unspecified role bait bait Region 551-680 Region 551-680 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction med25-dreb2a-2 7 10 unspecified role unspecified role prey prey Region 169-253 Region 169-253 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 13 unspecified role unspecified role bait bait Region 551-680 Region 551-680 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction med25-zhd11-2 2 12 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 13 unspecified role unspecified role bait bait Region 551-680 Region 551-680 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction med25-dreb2a-3 1 10 unspecified role unspecified role prey prey Region 169-355 Region 169-355 sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli 13 unspecified role unspecified role bait bait Region 551-680 Region 551-680 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction med25-phl1-2 9 11 unspecified role unspecified role prey prey Region 61-370 Region 61-370 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 13 unspecified role unspecified role bait bait Region 551-680 Region 551-680 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction med25-phl1-3 6 14 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 13 unspecified role unspecified role bait bait Region 551-680 Region 551-680 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction med25-zhd11-3 3 12 unspecified role unspecified role prey prey Region 1-132 Region 1-132 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 13 unspecified role unspecified role bait bait Region 551-680 Region 551-680 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction