DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu A cytoplasmic complex mediates specific mRNA recognition and localization in yeast. A cytoplasmic complex mediates specific mRNA recognition and localization in yeast. PLoS biology 2011 imex curation Müller M., Heym RG., Mayer A., Kramer K., Schmid M., Cramer P., Urlaub H., Jansen RP., Niessing D. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Müller M., Heym RG., Mayer A., Kramer K., Schmid M., Cramer P., Urlaub H., Jansen RP., Niessing D. DIP original experiment: DIP-216772X PLoS biology 2011 IMEx A cytoplasmic complex mediates specific mRNA recognition and localization in yeast. A cytoplasmic complex mediates specific mRNA recognition and localization in yeast. A cytoplasmic complex mediates specific mRNA recognition and localization in yeast. PLoS biology 2011 imex curation Müller M., Heym RG., Mayer A., Kramer K., Schmid M., Cramer P., Urlaub H., Jansen RP., Niessing D. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Müller M., Heym RG., Mayer A., Kramer K., Schmid M., Cramer P., Urlaub H., Jansen RP., Niessing D. DIP original experiment: DIP-216779X PLoS biology 2011 IMEx A cytoplasmic complex mediates specific mRNA recognition and localization in yeast. A cytoplasmic complex mediates specific mRNA recognition and localization in yeast. A cytoplasmic complex mediates specific mRNA recognition and localization in yeast. PLoS biology 2011 imex curation Müller M., Heym RG., Mayer A., Kramer K., Schmid M., Cramer P., Urlaub H., Jansen RP., Niessing D. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Müller M., Heym RG., Mayer A., Kramer K., Schmid M., Cramer P., Urlaub H., Jansen RP., Niessing D. DIP original experiment: DIP-216770X PLoS biology 2011 IMEx A cytoplasmic complex mediates specific mRNA recognition and localization in yeast. A cytoplasmic complex mediates specific mRNA recognition and localization in yeast. A cytoplasmic complex mediates specific mRNA recognition and localization in yeast. PLoS biology 2011 imex curation Müller M., Heym RG., Mayer A., Kramer K., Schmid M., Cramer P., Urlaub H., Jansen RP., Niessing D. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Müller M., Heym RG., Mayer A., Kramer K., Schmid M., Cramer P., Urlaub H., Jansen RP., Niessing D. DIP original experiment: DIP-216771X PLoS biology 2011 IMEx A cytoplasmic complex mediates specific mRNA recognition and localization in yeast. A cytoplasmic complex mediates specific mRNA recognition and localization in yeast. A cytoplasmic complex mediates specific mRNA recognition and localization in yeast. PLoS biology 2011 imex curation Müller M., Heym RG., Mayer A., Kramer K., Schmid M., Cramer P., Urlaub H., Jansen RP., Niessing D. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Müller M., Heym RG., Mayer A., Kramer K., Schmid M., Cramer P., Urlaub H., Jansen RP., Niessing D. DIP original experiment: DIP-216782X PLoS biology 2011 IMEx A cytoplasmic complex mediates specific mRNA recognition and localization in yeast. A cytoplasmic complex mediates specific mRNA recognition and localization in yeast. A cytoplasmic complex mediates specific mRNA recognition and localization in yeast. PLoS biology 2011 imex curation Müller M., Heym RG., Mayer A., Kramer K., Schmid M., Cramer P., Urlaub H., Jansen RP., Niessing D. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Müller M., Heym RG., Mayer A., Kramer K., Schmid M., Cramer P., Urlaub H., Jansen RP., Niessing D. DIP original experiment: DIP-216780X PLoS biology 2011 IMEx A cytoplasmic complex mediates specific mRNA recognition and localization in yeast. A cytoplasmic complex mediates specific mRNA recognition and localization in yeast. A cytoplasmic complex mediates specific mRNA recognition and localization in yeast. PLoS biology 2011 imex curation Müller M., Heym RG., Mayer A., Kramer K., Schmid M., Cramer P., Urlaub H., Jansen RP., Niessing D. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Müller M., Heym RG., Mayer A., Kramer K., Schmid M., Cramer P., Urlaub H., Jansen RP., Niessing D. DIP original experiment: DIP-216776X PLoS biology 2011 IMEx A cytoplasmic complex mediates specific mRNA recognition and localization in yeast. A cytoplasmic complex mediates specific mRNA recognition and localization in yeast. A cytoplasmic complex mediates specific mRNA recognition and localization in yeast. PLoS biology 2011 imex curation Müller M., Heym RG., Mayer A., Kramer K., Schmid M., Cramer P., Urlaub H., Jansen RP., Niessing D. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Müller M., Heym RG., Mayer A., Kramer K., Schmid M., Cramer P., Urlaub H., Jansen RP., Niessing D. DIP original experiment: DIP-216774X PLoS biology 2011 IMEx A cytoplasmic complex mediates specific mRNA recognition and localization in yeast. A cytoplasmic complex mediates specific mRNA recognition and localization in yeast. A cytoplasmic complex mediates specific mRNA recognition and localization in yeast. PLoS biology 2011 imex curation Müller M., Heym RG., Mayer A., Kramer K., Schmid M., Cramer P., Urlaub H., Jansen RP., Niessing D. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Müller M., Heym RG., Mayer A., Kramer K., Schmid M., Cramer P., Urlaub H., Jansen RP., Niessing D. DIP original experiment: DIP-216777X PLoS biology 2011 IMEx A cytoplasmic complex mediates specific mRNA recognition and localization in yeast. A cytoplasmic complex mediates specific mRNA recognition and localization in yeast. A cytoplasmic complex mediates specific mRNA recognition and localization in yeast. PLoS biology 2011 imex curation Müller M., Heym RG., Mayer A., Kramer K., Schmid M., Cramer P., Urlaub H., Jansen RP., Niessing D. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Müller M., Heym RG., Mayer A., Kramer K., Schmid M., Cramer P., Urlaub H., Jansen RP., Niessing D. DIP original experiment: DIP-216775X PLoS biology 2011 IMEx A cytoplasmic complex mediates specific mRNA recognition and localization in yeast. A cytoplasmic complex mediates specific mRNA recognition and localization in yeast. A cytoplasmic complex mediates specific mRNA recognition and localization in yeast. PLoS biology 2011 imex curation Müller M., Heym RG., Mayer A., Kramer K., Schmid M., Cramer P., Urlaub H., Jansen RP., Niessing D. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Müller M., Heym RG., Mayer A., Kramer K., Schmid M., Cramer P., Urlaub H., Jansen RP., Niessing D. DIP original experiment: DIP-216773X PLoS biology 2011 IMEx A cytoplasmic complex mediates specific mRNA recognition and localization in yeast. A cytoplasmic complex mediates specific mRNA recognition and localization in yeast. A cytoplasmic complex mediates specific mRNA recognition and localization in yeast. PLoS biology 2011 imex curation Müller M., Heym RG., Mayer A., Kramer K., Schmid M., Cramer P., Urlaub H., Jansen RP., Niessing D. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Müller M., Heym RG., Mayer A., Kramer K., Schmid M., Cramer P., Urlaub H., Jansen RP., Niessing D. DIP original experiment: DIP-216781X PLoS biology 2011 IMEx A cytoplasmic complex mediates specific mRNA recognition and localization in yeast. A cytoplasmic complex mediates specific mRNA recognition and localization in yeast. A cytoplasmic complex mediates specific mRNA recognition and localization in yeast. PLoS biology 2011 imex curation Müller M., Heym RG., Mayer A., Kramer K., Schmid M., Cramer P., Urlaub H., Jansen RP., Niessing D. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Müller M., Heym RG., Mayer A., Kramer K., Schmid M., Cramer P., Urlaub H., Jansen RP., Niessing D. DIP original experiment: DIP-216778X PLoS biology 2011 IMEx A cytoplasmic complex mediates specific mRNA recognition and localization in yeast. she3_yeast SWI5-dependent HO expression protein 3 YBR1005 YBR130C SHE3 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSDQDNTQTSSSKLAPHHNIFMANLESSPTKDRNTSSQNASSSRVIESLHDQIDMLTKTNLQLTTQSQNLLSKLELAQSKESKLLENLNLLKNENENLNSIFERKNKKLKELEKDYSELSNRYNEQKEKMDQLSKLAKNSSAIEQSCSEKLQNMEVNYNSLLESQNLYRDHYSDEISKLNEKIGLLELELSNQNLNYGSDTSSNSDIELNLNKFNDSVKDLKSLETEKDSKLSKIITHSLDELNLQSWLNLYQTNENLISTFAEKMDLKDVLKRNDEKISNKGAVVQTLKKNVQTQVESNNADALSSNNAQDMLPIKMVKLRKTPNTNDSSSNGNSSNNKRRSFYTASPLLSSGSIPKSASPVLPGVKRTASVRKPSSSSSKTNVTHNNDPSTSPTISVPPGVTRTVSSTHKKKGNSMVVHGAQS 590404D2E140BB7A 590404D2E140BB7A myo4_yeast Myosin-4 MYO4 SHE1 YAL029C FUN22 SWI5-dependent HO expression protein 1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSFEVGTKCWYPHKEQGWIGGEVTKNDFFEGTFHLELKLEDGETVSIETNSFENDDDHPTLPVLRNPPILESTDDLTTLSYLNEPAVLHAIKKRYMNGQIYTYSGIVLIAANPFDKVDHLYSREMIQNYSSKRKDELEPHLFAIAEEAYRFMVHEKANQTVVVSGESGAGKTVSAKYIMRYFASVQESNNREGEVEMSQIESQILATNPIMEAFGNAKTTRNDNSSRFGKYLQILFDENTTIRGSKIRTYLLEKSRLVYQPETERNYHIFYQILEGLPEPVKQELHLSSPKDYHYTNQGGQPNIAGIDEAREYKITTDALSLVGINHETQLGIFKILAGLLHIGNIEMKMTRNDASLSSEEQNLQIACELLGIDPFNFAKWIVKKQIVTRSEKIVTNLNYNQALIARDSVAKFIYSTLFDWLVDNINKTLYDPELDQQDHVFSFIGILDIYGFEHFEKNSFEQFCINYANEKLQQEFNQHVFKLEQEEYVKEEIEWSFIEFSDNQPCIDLIENKLGILSLLDEESRLPSGSDESWASKLYSAFNKPPSNEVFSKPRFGQTKFIVSHYAVDVEYEVEGFIEKNRDSVSLGHLDVFKATTNPIFKQILDNRELRSDDAPEEQNTEKKIMIPARLSQKKPTLGSMFKKSLGELMAIINSTNVHYIRCIKPNSEKKPWEFDNLMVLSQLRACGVLETIRISCAGFPSRWTFDEFVQRYFLLTDYSLWSGILYNPDLPKEAIVNFCQSILDATISDSAKYQIGNTKIFFKAGMLAFLEKLRTNKMNEICIIIQKKIRARYYRLQYLQTMESIKKCQSQIRSLLVRTRVDHELKTRAAILLQTNIRALWKREYYRAAIGQIIKLQCTCKRKLILDSVNRKFMLMAAVIIQSYIRSYGHKTDYRTLKRSSILVQSAMRMQLARRRYIVLQKEVEERNIRASYGIGLLEEAIEFKNSFILNLEMLNDSYTRLTQLLQGDLSNIPSKQRQEYETIVNGYNDKISKLKTLQVEIMNTLNKKNALKERKKKQSSLIQSHMQSLAAIKGNKPSRLSDEVKSMKQELAFIENVIAQDFTTTYSANKNDKVKGLGIAGQQVKPKLVNVIRRESGNPDLLELLMDLNCYTLEVTEGYLKKVNVTEVNGDNVLGPIHVITTVVSSLVRNGLLIQSSKFISKVLLTVESIVMSLPKDETMLGGIFWLSNLSRLPAFAANQKTLYEANGGDEKDKLTLIYLNDLENETLKVFDKIYSTWLVKFMKHASAHIEIFDMVLNEKLFKNSGDEKFAKLFTFLNEFDAVLCKFQVVDSMHTKIFNDTLKYLNVMLFNDLITKCPALNWKYGYEVDRNIERLVSWFEPRIEDVRPNLIQIIQAVKILQLKISNLNEFKLLFDFWYALNPAQIQAILLKYKPANKGEAGVPNEILNYLANVIKRENLSLPGKMEIMLSAQFDSAKNHLRYDTSAITQNSNTEGLATVSKIIKLDRK E79C0FE72B041E95 E79C0FE72B041E95 she2_yeast SWI5-dependent HO expression protein 2 YKL130C SHE2 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSKDKDIKVTPGTCELVEQILALLSRYLSSYIHVLNKFISHLRRVATLRFERTTLIKFVKKLRFYNDCVLSYNASEFINEGKNELDPEADSFDKVILPIASMFVKCVETFDLLNYYLTQSLQKEILSKTLNEDLTLTAESILAIDDTYNHFVKFSQWMIESLRIGSNLLDLEVVQFAIKCADEDGTNIGETDNIFLQEILPVNSEEEFQTLSAAWHSILDGKLSALDEEFDVVATKWHDKFGKLKN 5514B374655EFDBB 5514B374655EFDBB puf6_yeast Pumilio homology domain family member 6 PUF6 D9719.2 YDR496C protein protein yeast Saccharomyces cerevisiae Baker's yeast MAPLTKKTNGKRSAKEVSHSEKKLAKKPRISIDSSDEESELSKKEDAVSSSSDDDDLDDLSTSDSEAEEEADELDISDDSEEHENENEEKEGKDKSEGGENGNHTEQRKLLKERKMQRKSGTQVQQIKSVWERLRVKTPPLPKQIREKLSNEIWELSKDCISDLVLKHDASRIVQTLVKYSSKDRREQIVDALKGKFYVLATSAYGKYLLVKLLHYGSRSSRQTIINELHGSLRKLMRHREGAYVVEDLFVLYATHEQRQQMIKEFWGSEYAVFRETHKDLTIEKVCESSIEKRNIIARNLIGTITASVEKGSTGFQILHAAMREYVKIANEKEISEMIELLHEQFAELVHTPEGSDVACTLVARANAKERKLILKALKNHAEKLIKNEYGNIVFITILNCVDDTVLVFKTFSPTVKEHLQEFIIDKFGRRPWLYILLGLDGKYFSPIVKNELLRYIELSKATSKKDPLQRRHELLSKFAPMFLSTISKDYSSILTENLGCQFIAEVLINDELYAQLNEKDQEKYQQVLNNILTTFKGDITEEEHPIHRAFSTRLLKALIQGGKWNNKEKKVIPLKNVQGLGVPFAEKLYDEIIDSSNLLEWINNADSSFTIVALYETLKDQKEGKPFLKDLRGVQSKITTDESNKGSQLLAKLLK 4D172E8854326ECF 4D172E8854326ECF she2p-she3p-1 13 14 unspecified role unspecified role unspecified role unspecified role His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range C-terminal domain Region 334-425 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 16 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction she3p-she2p-1 3 14 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range P38272:p.[Leu364Ala;Val367Ala] L364A/V367A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain V A certain certain sequence position certain certain certain sequence position certain L A This feature has been corrected as a result of our quality control procedures. The original label was 'L364A/V367A'. Wed May 02 16:34:35 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu364ala,val367ala' Tue Jun 30 19:06:54 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Leu364Ala;Val367Ala]' trini Trichoplusia ni (Cabbage looper) Cabbage looper 16 unspecified role unspecified role prey prey ecolx Escherichia coli direct interaction direct interaction she2p-she3p-2 12 14 unspecified role unspecified role unspecified role unspecified role His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range trini Trichoplusia ni (Cabbage looper) Cabbage looper 16 unspecified role unspecified role unspecified role unspecified role region Δ164-179 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain This feature has been corrected as a result of our quality control procedures. The original label was 'Δ164-179'. ecolx Escherichia coli physical association physical association she3p-she2p-2 2 14 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range trini Trichoplusia ni (Cabbage looper) Cabbage looper 16 unspecified role unspecified role prey prey P36068:p.[Phe195Ala;Leu196Ala] F195A/L196A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L A certain certain sequence position certain certain certain sequence position certain F A This feature has been corrected as a result of our quality control procedures. The original label was 'F195A/L196A'. Wed May 02 15:35:49 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe195ala,leu196ala' Tue Jun 30 19:45:26 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Phe195Ala;Leu196Ala]' P36068:p.[Gln197Ala;Glu198Ala;Ile199Ala] Q197A/E198A/I199A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain I A certain certain sequence position certain certain certain sequence position certain E A certain certain sequence position certain certain certain sequence position certain Q A This feature has been corrected as a result of our quality control procedures. The original label was 'Q197A/E198A/I199A'. Wed May 02 15:42:46 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln197ala,glu198ala,ile199ala' Tue Jun 30 16:26:15 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Gln197Ala;Glu198Ala;Ile199Ala]' region Δ164-179 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain This feature has been corrected as a result of our quality control procedures. The original label was 'Δ164-179'. ecolx Escherichia coli direct interaction direct interaction she3p-she2p-3 4 14 unspecified role unspecified role bait bait trini Trichoplusia ni (Cabbage looper) Cabbage looper 16 unspecified role unspecified role prey prey region Δ164-179 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain This feature has been corrected as a result of our quality control procedures. The original label was 'Δ164-179'. ecolx Escherichia coli direct interaction direct interaction puf6p-she2p-1 10 14 unspecified role unspecified role prey prey His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range trini Trichoplusia ni (Cabbage looper) Cabbage looper 17 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 16 unspecified role unspecified role prey prey ecolx Escherichia coli association association she2p-1 5 16 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction Deletion of region 141-146 decreased the interaction rate/strength. puf6p-she2p-2 1 17 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 16 unspecified role unspecified role prey prey ecolx Escherichia coli physical association physical association she3p-puf6p-1 7 14 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range trini Trichoplusia ni (Cabbage looper) Cabbage looper 17 unspecified role unspecified role prey prey GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 16 unspecified role unspecified role prey prey ecolx Escherichia coli association association she2p-she3p-3 6 14 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 16 unspecified role unspecified role bait bait region Δ164-179 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain This feature has been corrected as a result of our quality control procedures. The original label was 'Δ164-179'. region Δ141-146 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain This feature has been corrected as a result of our quality control procedures. The original label was 'Δ141-146'. Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association she2p-she3p-4 11 14 unspecified role unspecified role unspecified role unspecified role His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range trini Trichoplusia ni (Cabbage looper) Cabbage looper 16 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction myo4p-she2p-1 8 15 unspecified role unspecified role unspecified role unspecified role C-terminal domain Region 923-1471 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 14 unspecified role unspecified role unspecified role unspecified role His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range trini Trichoplusia ni (Cabbage looper) Cabbage looper 16 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association she3p-she2p-4 9 14 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range C-terminal domain Region 334-425 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 16 unspecified role unspecified role prey prey ecolx Escherichia coli direct interaction direct interaction