DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Stem cell antigen-1 enhances tumorigenicity by disruption of growth differentiation factor-10 (GDF10)-dependent TGF-beta signaling. Stem cell antigen-1 enhances tumorigenicity by disruption of growth differentiation factor-10 (GDF10)-dependent TGF-beta signaling. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Upadhyay G., Yin Y., Yuan H., Li X., Derynck R., Glazer RI. Only protein-protein interactions mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Upadhyay G., Yin Y., Yuan H., Li X., Derynck R., Glazer RI. DIP original experiment: DIP-249232X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Stem cell antigen-1 enhances tumorigenicity by disruption of growth differentiation factor-10 (GDF10)-dependent TGF-beta signaling. Stem cell antigen-1 enhances tumorigenicity by disruption of growth differentiation factor-10 (GDF10)-dependent TGF-beta signaling. Stem cell antigen-1 enhances tumorigenicity by disruption of growth differentiation factor-10 (GDF10)-dependent TGF-beta signaling. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Upadhyay G., Yin Y., Yuan H., Li X., Derynck R., Glazer RI. Only protein-protein interactions mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Upadhyay G., Yin Y., Yuan H., Li X., Derynck R., Glazer RI. DIP original experiment: DIP-249230X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Stem cell antigen-1 enhances tumorigenicity by disruption of growth differentiation factor-10 (GDF10)-dependent TGF-beta signaling. Stem cell antigen-1 enhances tumorigenicity by disruption of growth differentiation factor-10 (GDF10)-dependent TGF-beta signaling. Stem cell antigen-1 enhances tumorigenicity by disruption of growth differentiation factor-10 (GDF10)-dependent TGF-beta signaling. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Upadhyay G., Yin Y., Yuan H., Li X., Derynck R., Glazer RI. Only protein-protein interactions mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Upadhyay G., Yin Y., Yuan H., Li X., Derynck R., Glazer RI. DIP original experiment: DIP-249231X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Stem cell antigen-1 enhances tumorigenicity by disruption of growth differentiation factor-10 (GDF10)-dependent TGF-beta signaling. tgfr1_mouse TGF-beta receptor type-1 Tgfbr1 Transforming growth factor-beta receptor type I ESK2 protein protein mouse Mus musculus Mouse MEAAAAAPRRPQLLIVLVAAATLLPGAKALQCFCHLCTKDNFTCETDGLCFVSVTETTDKVIHNSMCIAEIDLIPRDRPFVCAPSSKTGAVTTTYCCNQDHCNKIELPTTGPFSEKQSAGLGPVELAAVIAGPVCFVCIALMLMVYICHNRTVIHHRVPNEEDPSLDRPFISEGTTLKDLIYDMTTSGSGSGLPLLVQRTIARTIVLQESIGKGRFGEVWRGKWRGEEVAVKIFSSREERSWFREAEIYQTVMLRHENILGFIAADNKDNGTWTQLWLVSDYHEHGSLFDYLNRYTVTVEGMIKLALSTASGLAHLHMEIVGTQGKPAIAHRDLKSKNILVKKNGTCCIADLGLAVRHDSATDTIDIAPNHRVGTKRYMAPEVLDDSINMKHFESFKRADIYAMGLVFWEIARRCSIGGIHEDYQLPYYDLVPSDPSVEEMRKVVCEQKLRPNIPNRWQSCEALRVMAKIMRECWYANGAARLTALRIKKTLSQLSQQEGIKM DIP protein Q64729 original sequence version: 120 DIP protein Q64729 original sequence version: 131 DIP protein Q64729 original sequence version: 157 BB8BB6D2261793AF ly6a_mouse Lymphocyte antigen 6A-2/6E-1 Ly6a Ly6 Stem cell antigen 1 T-cell-activating protein protein protein mouse Mus musculus Mouse MDTSHTTKSCLLILLVALLCAERAQGLECYQCYGVPFETSCPSITCPYPDGVCVTQEAAVIVDSQTRKVKNNLCLPICPPNIESMEILGTKVNVKTSCCQEDLCNVAVPNGGSTWTMAGVLLFSLSSVLLQTLL DIP protein P05533 original sequence version: 112 883C771EB3430315 tgfr2_mouse TGF-beta receptor type-2 Tgfbr2 Transforming growth factor-beta receptor type II TGF-beta type II receptor protein protein mouse Mus musculus Mouse MGRGLLRGLWPLHIVLWTRIASTIPPHVPKSDVEMEAQKDASIHLSCNRTIHPLKHFNSDVMASDNGGAVKLPQLCKFCDVRLSTCDNQKSCMSNCSITAICEKPHEVCVAVWRKNDKNITLETVCHDPKLTYHGFTLEDAASPKCVMKEKKRAGETFFMCACNMEECNDYIIFSEEYTTSSPDLLLVIIQVTGVSLLPPLGIAIAVIIIFYCYRVHRQQKLSPSWESSKPRKLMDFSDNCAIILEDDRSDISSTCANNINHNTELLPIELDTLVGKGRFAEVYKAKLKQNTSEQFETVAVKIFPYEEYSSWKTEKDIFSDINLKHENILQFLTAEERKTELGKQYWLITAFHAKGNLQEYLTRHVISWEDLRKLGSSLARGIAHLHSDHTPCGRPKMPIVHRDLKSSNILVKNDLTCCLCDFGLSLRLDPTLSVDDLANSGQVGTARYMAPEVLESRMNLENVESFKQTDVYSMALVLWEMTSRCNAVGEVKDYEPPFGSKVREHPCVESMKDSVLRDRGRPEIPSFWLNHQGIQIVCETLTECWDHDPEARLTAQCVAERFSELEHPERLSGRSCSQEKIPEDGSLNTTK DIP protein Q62312 original sequence version: 121 DIP protein Q62312 original sequence version: 129 1A12D58550921F5E ly6a-tgfbr1-1 2 4 unspecified role unspecified role prey prey mouse Mus musculus Mouse 5 unspecified role unspecified role bait bait mouse Mus musculus Mouse physical association physical association tgfbr1-tgfbr2-1 3 6 unspecified role unspecified role prey prey mouse Mus musculus Mouse 4 unspecified role unspecified role bait bait mouse Mus musculus Mouse physical association physical association tgfbr1-ly6a-1 1 4 unspecified role unspecified role bait bait mouse Mus musculus Mouse 5 unspecified role unspecified role prey prey mouse Mus musculus Mouse physical association physical association