DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Structural insights into the architecture and allostery of full-length AMP-activated protein kinase. Structural insights into the architecture and allostery of full-length AMP-activated protein kinase. Structure (London, England : 1993) 2011 imex curation Zhu L., Chen L., Zhou XM., Zhang YY., Zhang YJ., Zhao J., Ji SR., Wu JW., Wu Y. Only protein-protein interactions ecolx Escherichia coli ion exchange chrom ion exchange chromatography IEC IEC ion exchange chrom predetermined predetermined participant predetermined Zhu L., Chen L., Zhou XM., Zhang YY., Zhang YJ., Zhao J., Ji SR., Wu JW., Wu Y. DIP original experiment: DIP-218803X Structure (London, England : 1993) 2011 IMEx Structural insights into the architecture and allostery of full-length AMP-activated protein kinase. Structural insights into the architecture and allostery of full-length AMP-activated protein kinase. Structural insights into the architecture and allostery of full-length AMP-activated protein kinase. Structure (London, England : 1993) 2011 imex curation Zhu L., Chen L., Zhou XM., Zhang YY., Zhang YJ., Zhao J., Ji SR., Wu JW., Wu Y. Only protein-protein interactions ecolx Escherichia coli pull down pull down predetermined predetermined participant predetermined Zhu L., Chen L., Zhou XM., Zhang YY., Zhang YJ., Zhao J., Ji SR., Wu JW., Wu Y. DIP original experiment: DIP-218802X Structure (London, England : 1993) 2011 IMEx Structural insights into the architecture and allostery of full-length AMP-activated protein kinase. Structural insights into the architecture and allostery of full-length AMP-activated protein kinase. Structural insights into the architecture and allostery of full-length AMP-activated protein kinase. Structure (London, England : 1993) 2011 imex curation Zhu L., Chen L., Zhou XM., Zhang YY., Zhang YJ., Zhao J., Ji SR., Wu JW., Wu Y. Only protein-protein interactions ecolx Escherichia coli tem transmission electron microscopy tem predetermined predetermined participant predetermined Zhu L., Chen L., Zhou XM., Zhang YY., Zhang YJ., Zhao J., Ji SR., Wu JW., Wu Y. DIP original experiment: DIP-218805X Structure (London, England : 1993) 2011 IMEx Structural insights into the architecture and allostery of full-length AMP-activated protein kinase. Structural insights into the architecture and allostery of full-length AMP-activated protein kinase. Structural insights into the architecture and allostery of full-length AMP-activated protein kinase. Structure (London, England : 1993) 2011 imex curation Zhu L., Chen L., Zhou XM., Zhang YY., Zhang YJ., Zhao J., Ji SR., Wu JW., Wu Y. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Zhu L., Chen L., Zhou XM., Zhang YY., Zhang YJ., Zhao J., Ji SR., Wu JW., Wu Y. DIP original experiment: DIP-218804X Structure (London, England : 1993) 2011 IMEx Structural insights into the architecture and allostery of full-length AMP-activated protein kinase. aakb1_rat 5'-AMP-activated protein kinase subunit beta-1 Prkab1 5'-AMP-activated protein kinase 40 kDa subunit protein protein rat Rattus norvegicus (Rat) Rat MGNTSSERAALERQAGHKTPRRDSSGGTKDGDRPKILMDSPEDADIFHTEEMKAPEKEEFLAWQHDLEVNEKAPAQARPTVFRWTGGGKEVYLSGSFNNWSKLPLTRSQNNFVAILDLPEGEHQYKFFVDGQWTHDPSEPIVTSQLGTVNNIIQVKKTDFEVFDALMVDSQKCSDVSELSSSPPGPYHQEPYISKPEERFKAPPILPPHLLQVILNKDTGISCDPALLPEPNHVMLNHLYALSIKDGVMVLSATHRYKKKYVTTLLYKPI DIP protein P80386 original sequence version: 108 DIP protein P80386 original sequence version: 137 DIP protein P80386 original sequence version: 118 aapk1_rat 5'-AMP-activated protein kinase catalytic subunit alpha-1 Prkaa1 Ampk1 Hydroxymethylglutaryl-CoA reductase kinase Tau-protein kinase PRKAA1 Acetyl-CoA carboxylase kinase protein protein rat Rattus norvegicus (Rat) Rat MRRLSSWRKMATAEKQKHDGRVKIGHYILGDTLGVGTFGKVKVGKHELTGHKVAVKILNRQKIRSLDVVGKIRREIQNLKLFRHPHIIKLYQVISTPSDIFMVMEYVSGGELFDYICKNGRLDEKESRRLFQQILSGVDYCHRHMVVHRDLKPENVLLDAHMNAKIADFGLSNMMSDGEFLRTSCGSPNYAAPEVISGRLYAGPEVDIWSSGVILYALLCGTLPFDDDHVPTLFKKICDGIFYTPQYLNPSVISLLKHMLQVDPMKRATIKDIREHEWFKQDLPKYLFPEDPSYSSTMIDDEALKEVCEKFECSEEEVLSCLYNRNHQDPLAVAYHLIIDNRRIMNEAKDFYLATSPPDSFLDDHHLTRPHPERVPFLVAETPRARHTLDELNPQKSKHQGVRKAKWHLGIRSQSRPNDIMAEVCRAIKQLDYEWKVVNPYYLRVRRKNPVTSTFSKMSLQLYQVDSRTYLLDFRSIDDEITEAKSGTATPQRSGSISNYRSCQRSDSDAEAQGKPSEVSLTSSVTSLDSSPVDVAPRPGSHTIEFFEMCANLIKILAQ DIP protein P54645 original sequence version: 125 DIP protein P54645 original sequence version: 104 DIP protein P54645 original sequence version: 138 DIP protein P54645 original sequence version: 118 Responsible for the regulation of fatty acid synthesis by phosphorylation of acetyl-CoA carboxylase. It also regulates cholesterol synthesis via phosphorylation and inactivation of hormone-sensitive lipase and hydroxymethylglutaryl-CoA reductase. Appears to act as a metabolic stress-sensing protein kinase switching off biosynthetic pathways when cellular ATP levels are depleted and when 5'-AMP rises in response to fuel limitation and/or hypoxia. This is a catalytic subunit mint A869C340A85785ED aakg1_rat 5'-AMP-activated protein kinase subunit gamma-1 Prkag1 protein protein rat Rattus norvegicus (Rat) Rat MESVAAESAPAPENEHSQETPESNSSVYTTFMKSHRCYDLIPTSSKLVVFDTSLQVKKAFFALVTNGVRAAPLWDSKKQSFVGMLTITDFINILHRYYKSALVQIYELEEHKIETWREVYLQDSFKPLVCISPNASLFDAVSSLIRNKIHRLPVIDPESGNTLYILTHKRILKFLKLFITEFPKPEFMSKSLEELQIGTYANIAMVRTTTPVYVALGIFVQHRVSALPVVDEKGRVVDIYSKFDVINLAAEKTYNNLDVSVTKALQHRSHYFEGVLKCYLHETLEAIINRLVEAEVHRLVVVDEHDVVKGIVSLSDILQALVLTGGEKKP DIP protein P80385 original sequence version: 97 DIP protein P80385 original sequence version: 79 DIP protein P80385 original sequence version: 108 DIP protein P80385 original sequence version: 89 36031E526C1F1E97 prkaa1-prkab1-1 2 6 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 7 unspecified role unspecified role prey prey ecolx Escherichia coli 5 unspecified role unspecified role prey prey ecolx Escherichia coli association association prkaa1-prkab1-2 4 6 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 7 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 5 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association prkaa1-prkab1-3 1 6 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 7 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 5 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli association association prkaa1-prkab1-4 3 6 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 7 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 5 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association