IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Identification and characterization of KCASH2 and KCASH3, 2 novel Cullin3 adaptors suppressing histone deacetylase and Hedgehog activity in medulloblastoma. Identification and characterization of KCASH2 and KCASH3, 2 novel Cullin3 adaptors suppressing histone deacetylase and Hedgehog activity in medulloblastoma. Neoplasia (New York, N.Y.) 2011 imex curation De Smaele E., Di Marcotullio L., Moretti M., Pelloni M., Occhione MA., Infante P., Cucchi D., Greco A., Pietrosanti L., Todorovic J., Coni S., Canettieri G., Ferretti E., Bei R., Maroder M., Screpanti I., Gulino A. Results from figures 3 and 4 have not been annotated as the origins of Cullin3-myc and HA-HDAC1 cannot be traced. email sent-21/9/17 for figs 3/4 myc-cullin3 and HA-HDAC1(+flag). Email bounced - corresponding author died in 2014. [Cullin 3 - the rat/mouse/human sequences are identical at N-terminus and M. Pagano - donor- seems to use Drosophila Cul3) I cannot find any better match for the KCASH1 protein -no NCBI identifier given for it, nor is there one in Ref18. Uniprot blast is not working, and get errors or very strange results from NCBI blast and no links to any "Protein Identifier" work -however I got a "97%" match to Q693B1-2 from Expasy Blast -one aa difference from aas 16-49 -which is as far as I got with typing from the PDF file. The nearest match to the sequence of Human KCASH1/KCTD11 (as given in Supplementary figure W1) corresponds to Uniprot identifier Q693B1-2, although the protein length, N-terminal sequence and a few residues differ slightly. alberto.gulino@uniroma1.it 19-Dec-2017: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western De Smaele E., Di Marcotullio L., Moretti M., Pelloni M., Occhione MA., Infante P., Cucchi D., Greco A., Pietrosanti L., Todorovic J., Coni S., Canettieri G., Ferretti E., Bei R., Maroder M., Screpanti I., Gulino A. Results from figures 3 and 4 have not been annotated as the origins of Cullin3-myc and HA-HDAC1 cannot be traced. email sent-21/9/17 for figs 3/4 myc-cullin3 and HA-HDAC1(+flag). Email bounced - corresponding author died in 2014. [Cullin 3 - the rat/mouse/human sequences are identical at N-terminus and M. Pagano - donor- seems to use Drosophila Cul3) The nearest match to the sequence of Human KCASH1/KCTD11 (as given in Supplementary figure W1) corresponds to Uniprot identifier Q693B1-2, although the protein length, N-terminal sequence and a few residues differ slightly. alberto.gulino@uniroma1.it Accepted 2017-NOV-09 AT 13:51 GMT AT 13:51 GMT by PPORRAS Neoplasia (New York, N.Y.) 2011 Only protein-protein interactions imex curation imex curation kctd6_human BTB/POZ domain-containing protein KCTD6 KCTD6 KCASH3 protein Potassium channel tetramerization domain-containing protein 6 protein protein human Homo sapiens Human MDNGDWGYMMTDPVTLNVGGHLYTTSLTTLTRYPDSMLGAMFGGDFPTARDPQGNYFIDRDGPLFRYVLNFLRTSELTLPLDFKEFDLLRKEADFYQIEPLIQCLNDPKPLYPMDTFEEVVELSSTRKLSKYSNPVAVIITQLTITTKVHSLLEGISNYFTKWNKHMMDTRDCQVSFTFGPCDYHQEVSLRVHLMEYITKQGFTIRNTRVHHMSERANENTVEHNWTFCRLARKTDD 6358D9993DD060ED kcd21_human BTB/POZ domain-containing protein KCTD21 KCTD21 KCASH2 protein Potassium channel tetramerization domain-containing protein 21 protein protein human Homo sapiens Human MSDPITLNVGGKLYTTSLATLTSFPDSMLGAMFSGKMPTKRDSQGNCFIDRDGKVFRYILNFLRTSHLDLPEDFQEMGLLRREADFYQVQPLIEALQEKEVELSKAEKNAMLNITLNQRVQTVHFTVREAPQIYSLSSSSMEVFNANIFSTSCLFLKLLGSKLFYCSNGNLSSITSHLQDPNHLTLDWVANVEGLPEEEYTKQNLKRLWVVPANKQINSFQVFVEEVLKIALSDGFCIDSSHPHALDFMNNKIIRLIRYR E94BAD422C106070 q693b1-2 Isoform 2 of BTB/POZ domain-containing protein KCTD11 KCTD11 C17orf36 REN lKCTD11 protein protein human Homo sapiens Human MSPPPVPSSPPSFGGPVTLNVGGTLYSTTLETLTRFPDSMLGAMFRAGTPMPPNLNSQGGGHYFIDRDGKAFRHILNFLRLGRLDLPRGYGETALLRAEADFYQIRPLLDALRELEASQGTPAPTAALLHADVDVSPRLVHFSARRGPHHYELSSVQVDTFRANLFCTDSECLGALRARFGVASGDRAEGSPHFHLEWAPRPVELPEVEYGRLGLQPLWTGGPGERREVVGTPSFLEEVLRVALEHGFRLDSVFPDPEDLLNSRSLRFVRH 79D501B415B3B608 kctd11-kctd11-2 1 4 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 4 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined btb_domain required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain physical association physical association 2A kctd11-kctd11-3 1 3 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 3 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined btb_domain required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain physical association physical association 2A-2 kctd21-kctd21-3 1 2 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 2 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 2A-3 kctd21-kctd21-4 1 4 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 3 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 2B kctd21-kctd11-1 1 3 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 2 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 2C kctd21-kctd11-2 1 4 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 2 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 2D