DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu A novel mechanism of programmed cell death in bacteria by toxin-antitoxin systems corrupts peptidoglycan synthesis. A novel mechanism of programmed cell death in bacteria by toxin-antitoxin systems corrupts peptidoglycan synthesis. PLoS biology 2011 imex curation Mutschler H., Gebhardt M., Shoeman RL., Meinhart A. Only protein-protein interactions ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Mutschler H., Gebhardt M., Shoeman RL., Meinhart A. DIP original experiment: DIP-216767X PLoS biology 2011 IMEx A novel mechanism of programmed cell death in bacteria by toxin-antitoxin systems corrupts peptidoglycan synthesis. A novel mechanism of programmed cell death in bacteria by toxin-antitoxin systems corrupts peptidoglycan synthesis. A novel mechanism of programmed cell death in bacteria by toxin-antitoxin systems corrupts peptidoglycan synthesis. PLoS biology 2011 imex curation Mutschler H., Gebhardt M., Shoeman RL., Meinhart A. Only protein-protein interactions in vitro In vitro atpase assay atpase assay predetermined predetermined participant predetermined Mutschler H., Gebhardt M., Shoeman RL., Meinhart A. DIP original experiment: DIP-216768X PLoS biology 2011 IMEx A novel mechanism of programmed cell death in bacteria by toxin-antitoxin systems corrupts peptidoglycan synthesis. eatx_strpy Antitoxin epsilon protein protein strpy Streptococcus pyogenes MAVTYEKTFEIEIINELSASVYNRVLNYVLNHELNKNDSQLLEVNLLNQLKLAKRVNLFDYSLEELQAVHEYWRSMNRYSKQVLNKEKVA DIP protein Q57231 original sequence version: 53 31628C7F2FDE4B50 pezt_strpn Toxin PezT pezT UDP-N-acetylglucosamine kinase Zeta toxin SP_1051 protein protein strpn Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) MEIQDYTDSEFKHALARNLRSLTRGKKSSKQPIAILLGGQSGAGKTTIHRIKQKEFQGNIVIIDGDSFRSQHPHYLELQQEYGKDSVEYTKDFAGKMVESLVTKLSSLRYNLLIEGTLRTVDVPKKTAQLLKNKGYEVQLALIATKPELSYLSTLIRYEELYIINPNQARATPKEHHDFIVNHLVDNTRKLEELAIFERIQIYQRDRSCVYDSKENTTSAADVLQELLFGEWSQVEKEMLQVGEKRLNELLEK 0F7CD8D0B26EE89E peza_strpn Antitoxin PezA pezA SP_1050 protein protein strpn Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) MIGKNIKSLRKTHDLTQLEFARIVGISRNSLSRYENGTSSVSTELIDIICQKFNVSYVDIVGEDKMLNPVEDYELTLKIEIVKERGANLLSRLYRYQDSQGISIDDESNPWILMSDDLSDLIHTNIYLVETFDEIERYSGYLDGIERMLEISEKRMVA 0ABB5257446881C5 0ABB5257446881C5 ztox_strpy Toxin zeta UDP-N-acetylglucosamine kinase protein protein strpy Streptococcus pyogenes MANIVNFTDKQFENRLNDNLEELIQGKKAVESPTAFLLGGQPGSGKTSLRSAIFEETQGNVIVIDNDTFKQQHPNFDELVKLYEKDVVKHVTPYSNRMTEAIISRLSDQGYNLVIEGTGRTTDVPIQTATMLQAKGYETKMYVMAVPKINSYLGTIERYETMYADDPMTARATPKQAHDIVVKNLPTNLETLHKTGLFSDIRLYNREGVKLYSSLETPSISPKETLEKELNRKVSGKEIQPTLERIEQKMVLNKHQETPEFKAIQQKLESLQPPTPPIPKTPKLPGI DIP protein Q54944 original sequence version: 61 B0C6282EE5B2210F eatx_strpy-ztox_strpy-1 1 6 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 3 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction peza-pezt-1 2 4 unspecified role unspecified role unspecified role unspecified role Region 1-242 Region 1-242 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 5 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction