DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Structural organization of brain-derived mammalian prions examined by hydrogen-deuterium exchange. Structural organization of brain-derived mammalian prions examined by hydrogen-deuterium exchange. Nature structural & molecular biology 2011 imex curation Smirnovas V., Baron GS., Offerdahl DK., Raymond GJ., Caughey B., Surewicz WK. Only protein-protein interactions in vitro In vitro atomic force microsc atomic force microscopy AFM AFM atomic force microsc predetermined predetermined participant predetermined Smirnovas V., Baron GS., Offerdahl DK., Raymond GJ., Caughey B., Surewicz WK. DIP original experiment: DIP-218525X Nature structural & molecular biology 2011 IMEx Structural organization of brain-derived mammalian prions examined by hydrogen-deuterium exchange. Structural organization of brain-derived mammalian prions examined by hydrogen-deuterium exchange. Structural organization of brain-derived mammalian prions examined by hydrogen-deuterium exchange. Nature structural & molecular biology 2011 imex curation Smirnovas V., Baron GS., Offerdahl DK., Raymond GJ., Caughey B., Surewicz WK. Only protein-protein interactions mouse Mus musculus Mouse tem transmission electron microscopy tem predetermined predetermined participant predetermined Smirnovas V., Baron GS., Offerdahl DK., Raymond GJ., Caughey B., Surewicz WK. DIP original experiment: DIP-218524X Nature structural & molecular biology 2011 IMEx Structural organization of brain-derived mammalian prions examined by hydrogen-deuterium exchange. prio_mouse Major prion protein PrP27-30 PrP33-35C Prnp Prn-p Prp protein protein mouse Mus musculus Mouse MANLGYWLLALFVTMWTDVGLCKKRPKPGGWNTGGSRYPGQGSPGGNRYPPQGGTWGQPHGGGWGQPHGGSWGQPHGGSWGQPHGGGWGQGGGTHNQWNKPSKPKTNLKHVAGAAAAGAVVGGLGGYMLGSAMSRPMIHFGNDWEDRYYRENMYRYPNQVYYRPVDQYSNQNNFVHDCVNITIKQHTVTTTTKGENFTETDVKMMERVVEQMCVTQYQKESQAYYDGRRSSSTVLFSSPPVILLISFLIFLIVG DIP protein P04925 original sequence version: 157 DIP protein P04925 original sequence version: 140 DIP protein P04925 original sequence version: 122 DIP protein P04925 original sequence version: 117 DIP protein P04925 original sequence version: 132 DIP protein P04925 original sequence version: 128 D5331E6321826CC0 prnp-29 2 3 unspecified role unspecified role unspecified role unspecified role mouse Mus musculus Mouse physical association physical association prnp-30 1 3 unspecified role unspecified role unspecified role unspecified role Region 89-231 Region 89-231 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction