DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Jasmonate signaling involves the abscisic acid receptor PYL4 to regulate metabolic reprogramming in Arabidopsis and tobacco. Jasmonate signaling involves the abscisic acid receptor PYL4 to regulate metabolic reprogramming in Arabidopsis and tobacco. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Lackman P., González-Guzmán M., Tilleman S., Carqueijeiro I., Pérez AC., Moses T., Seo M., Kanno Y., Häkkinen ST., Van Montagu MC., Thevelein JM., Maaheimo H., Oksman-Caldentey KM., Rodriguez PL., Rischer H., Goossens A. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Lackman P., González-Guzmán M., Tilleman S., Carqueijeiro I., Pérez AC., Moses T., Seo M., Kanno Y., Häkkinen ST., Van Montagu MC., Thevelein JM., Maaheimo H., Oksman-Caldentey KM., Rodriguez PL., Rischer H., Goossens A. DIP original experiment: DIP-249215X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Jasmonate signaling involves the abscisic acid receptor PYL4 to regulate metabolic reprogramming in Arabidopsis and tobacco. Jasmonate signaling involves the abscisic acid receptor PYL4 to regulate metabolic reprogramming in Arabidopsis and tobacco. Jasmonate signaling involves the abscisic acid receptor PYL4 to regulate metabolic reprogramming in Arabidopsis and tobacco. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Lackman P., González-Guzmán M., Tilleman S., Carqueijeiro I., Pérez AC., Moses T., Seo M., Kanno Y., Häkkinen ST., Van Montagu MC., Thevelein JM., Maaheimo H., Oksman-Caldentey KM., Rodriguez PL., Rischer H., Goossens A. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Lackman P., González-Guzmán M., Tilleman S., Carqueijeiro I., Pérez AC., Moses T., Seo M., Kanno Y., Häkkinen ST., Van Montagu MC., Thevelein JM., Maaheimo H., Oksman-Caldentey KM., Rodriguez PL., Rischer H., Goossens A. DIP original experiment: DIP-249214X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Jasmonate signaling involves the abscisic acid receptor PYL4 to regulate metabolic reprogramming in Arabidopsis and tobacco. Jasmonate signaling involves the abscisic acid receptor PYL4 to regulate metabolic reprogramming in Arabidopsis and tobacco. Jasmonate signaling involves the abscisic acid receptor PYL4 to regulate metabolic reprogramming in Arabidopsis and tobacco. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Lackman P., González-Guzmán M., Tilleman S., Carqueijeiro I., Pérez AC., Moses T., Seo M., Kanno Y., Häkkinen ST., Van Montagu MC., Thevelein JM., Maaheimo H., Oksman-Caldentey KM., Rodriguez PL., Rischer H., Goossens A. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Lackman P., González-Guzmán M., Tilleman S., Carqueijeiro I., Pérez AC., Moses T., Seo M., Kanno Y., Häkkinen ST., Van Montagu MC., Thevelein JM., Maaheimo H., Oksman-Caldentey KM., Rodriguez PL., Rischer H., Goossens A. DIP original experiment: DIP-249217X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Jasmonate signaling involves the abscisic acid receptor PYL4 to regulate metabolic reprogramming in Arabidopsis and tobacco. Jasmonate signaling involves the abscisic acid receptor PYL4 to regulate metabolic reprogramming in Arabidopsis and tobacco. Jasmonate signaling involves the abscisic acid receptor PYL4 to regulate metabolic reprogramming in Arabidopsis and tobacco. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Lackman P., González-Guzmán M., Tilleman S., Carqueijeiro I., Pérez AC., Moses T., Seo M., Kanno Y., Häkkinen ST., Van Montagu MC., Thevelein JM., Maaheimo H., Oksman-Caldentey KM., Rodriguez PL., Rischer H., Goossens A. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Lackman P., González-Guzmán M., Tilleman S., Carqueijeiro I., Pérez AC., Moses T., Seo M., Kanno Y., Häkkinen ST., Van Montagu MC., Thevelein JM., Maaheimo H., Oksman-Caldentey KM., Rodriguez PL., Rischer H., Goossens A. DIP original experiment: DIP-249216X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Jasmonate signaling involves the abscisic acid receptor PYL4 to regulate metabolic reprogramming in Arabidopsis and tobacco. Jasmonate signaling involves the abscisic acid receptor PYL4 to regulate metabolic reprogramming in Arabidopsis and tobacco. Jasmonate signaling involves the abscisic acid receptor PYL4 to regulate metabolic reprogramming in Arabidopsis and tobacco. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Lackman P., González-Guzmán M., Tilleman S., Carqueijeiro I., Pérez AC., Moses T., Seo M., Kanno Y., Häkkinen ST., Van Montagu MC., Thevelein JM., Maaheimo H., Oksman-Caldentey KM., Rodriguez PL., Rischer H., Goossens A. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Lackman P., González-Guzmán M., Tilleman S., Carqueijeiro I., Pérez AC., Moses T., Seo M., Kanno Y., Häkkinen ST., Van Montagu MC., Thevelein JM., Maaheimo H., Oksman-Caldentey KM., Rodriguez PL., Rischer H., Goossens A. DIP original experiment: DIP-249212X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Jasmonate signaling involves the abscisic acid receptor PYL4 to regulate metabolic reprogramming in Arabidopsis and tobacco. Jasmonate signaling involves the abscisic acid receptor PYL4 to regulate metabolic reprogramming in Arabidopsis and tobacco. Jasmonate signaling involves the abscisic acid receptor PYL4 to regulate metabolic reprogramming in Arabidopsis and tobacco. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Lackman P., González-Guzmán M., Tilleman S., Carqueijeiro I., Pérez AC., Moses T., Seo M., Kanno Y., Häkkinen ST., Van Montagu MC., Thevelein JM., Maaheimo H., Oksman-Caldentey KM., Rodriguez PL., Rischer H., Goossens A. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Lackman P., González-Guzmán M., Tilleman S., Carqueijeiro I., Pérez AC., Moses T., Seo M., Kanno Y., Häkkinen ST., Van Montagu MC., Thevelein JM., Maaheimo H., Oksman-Caldentey KM., Rodriguez PL., Rischer H., Goossens A. DIP original experiment: DIP-249213X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Jasmonate signaling involves the abscisic acid receptor PYL4 to regulate metabolic reprogramming in Arabidopsis and tobacco. q53hy7_tobac c17 LOC107816664 protein protein tobac Nicotiana tabacum (Common tobacco) Common tobacco MPPSSPDSSVLLQRISSNTTPDFACKQSQQLQRRTMPIPCTTQVPDSVVRFHTHPVGPNQCCSAVIQRISAPVSTVWSVVRRFDNPQAYKHFVKSCHVIVGDGDVGTLREVRVISGLPAASSTERLEILDDERHVISFSVVGGDHRLANYRSVTTLHPEPSGDGTTIVVESYVVDVPPGNTRDETCVFVDTIVKCNLTSLSQIAVNVNRRKDS DIP protein Q53HY7 original sequence version: 22 p2c37_arath Protein phosphatase 2C 37 F24K9.8 At3g11410 PP2CA AHG3 Protein ABA-HYPERSENSITIVE GERMINATION 3 Protein phosphatase 2C A protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAGICCGVVGETEPAAPVDSTSRASLRRRLDLLPSIKIVADSAVAPPLENCRKRQKRETVVLSTLPGNLDLDSNVRSENKKARSAVTNSNSVTEAESFFSDVPKIGTTSVCGRRRDMEDAVSIHPSFLQRNSENHHFYGVFDGHGCSHVAEKCRERLHDIVKKEVEVMASDEWTETMVKSFQKMDKEVSQRECNLVVNGATRSMKNSCRCELQSPQCDAVGSTAVVSVVTPEKIIVSNCGDSRAVLCRNGVAIPLSVDHKPDRPDELIRIQQAGGRVIYWDGARVLGVLAMSRAIGDNYLKPYVIPDPEVTVTDRTDEDECLILASDGLWDVVPNETACGVARMCLRGAGAGDDSDAAHNACSDAALLLTKLALARQSSDNVSVVVVDLRKRRNNQASS DIP protein P49598 original sequence version: 79 DIP protein P49598 original sequence version: 80 DIP protein P49598 original sequence version: 95 DIP protein P49598 original sequence version: 130 83B82E32FEC71D4D p2c56_arath Protein phosphatase 2C 56 Protein ABSCISIC ACID-INSENSITIVE 1 ABI1 At4g26080 F20B18.190 Protein phosphatase 2C ABI1 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEEVSPAIAGPFRPFSETQMDFTGIRLGKGYCNNQYSNQDSENGDLMVSLPETSSCSVSGSHGSESRKVLISRINSPNLNMKESAAADIVVVDISAGDEINGSDITSEKKMISRTESRSLFEFKSVPLYGFTSICGRRPEMEDAVSTIPRFLQSSSGSMLDGRFDPQSAAHFFGVYDGHGGSQVANYCRERMHLALAEEIAKEKPMLCDGDTWLEKWKKALFNSFLRVDSEIESVAPETVGSTSVVAVVFPSHIFVANCGDSRAVLCRGKTALPLSVDHKPDREDEAARIEAAGGKVIQWNGARVFGVLAMSRSIGDRYLKPSIIPDPEVTAVKRVKEDDCLILASDGVWDVMTDEEACEMARKRILLWHKKNAVAGDASLLADERRKEGKDPAAMSAAEYLSKLAIQRGSKDNISVVVVDLKPRRKLKSKPLN DIP protein P49597 original sequence version: 104 DIP protein P49597 original sequence version: 101 DIP protein P49597 original sequence version: 106 DIP protein P49597 original sequence version: 102 DIP protein P49597 original sequence version: 116 DIP protein P49597 original sequence version: 107 DIP protein P49597 original sequence version: 124 DIP protein P49597 original sequence version: 161 4A4C54F04195F572 p2c16_arath Protein phosphatase 2C 16 HAB1 P2C-HA Protein phosphatase 2C HAB1 AtP2C-HA Protein HYPERSENSITIVE TO ABA 1 F28P22.4 At1g72770 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEEMTPAVAMTLSLAANTMCESSPVEITQLKNVTDAADLLSDSENQSFCNGGTECTMEDVSELEEVGEQDLLKTLSDTRSGSSNVFDEDDVLSVVEDNSAVISEGLLVVDAGSELSLSNTAMEIDNGRVLATAIIVGESSIEQVPTAEVLIAGVNQDTNTSEVVIRLPDENSNHLVKGRSVYELDCIPLWGTVSIQGNRSEMEDAFAVSPHFLKLPIKMLMGDHEGMSPSLTHLTGHFFGVYDGHGGHKVADYCRDRLHFALAEEIERIKDELCKRNTGEGRQVQWDKVFTSCFLTVDGEIEGKIGRAVVGSSDKVLEAVASETVGSTAVVALVCSSHIVVSNCGDSRAVLFRGKEAMPLSVDHKPDREDEYARIENAGGKVIQWQGARVFGVLAMSRSIGDRYLKPYVIPEPEVTFMPRSREDECLILASDGLWDVMNNQEVCEIARRRILMWHKKNGAPPLAERGKGIDPACQAAADYLSMLALQKGSKDNISIIVIDLKAQRKFKTRT DIP protein Q9CAJ0 original sequence version: 64 DIP protein Q9CAJ0-1 original sequence version: 62 DIP protein Q9CAJ0-1 original sequence version: 77 DIP protein Q9CAJ0 original sequence version: 62 DIP protein Q9CAJ0 original sequence version: 65 DIP protein Q9CAJ0-1 original sequence version: 66 DIP protein Q9CAJ0 original sequence version: 81 DIP protein Q9CAJ0-1 original sequence version: 86 DIP protein Q9CAJ0-1 original sequence version: 108 DIP protein Q9CAJ0 original sequence version: 112 DIP protein Q9CAJ0-1 original sequence version: 81 B001BAF0DD8333E1 pyl4_arath Abscisic acid receptor PYL4 At2g38310 PYL4 ABIP2 RCAR10 PYR1-like protein 4 ABI1-binding protein 2 Regulatory components of ABA receptor 10 T19C21.20 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MLAVHRPSSAVSDGDSVQIPMMIASFQKRFPSLSRDSTAARFHTHEVGPNQCCSAVIQEISAPISTVWSVVRRFDNPQAYKHFLKSCSVIGGDGDNVGSLRQVHVVSGLPAASSTERLDILDDERHVISFSVVGGDHRLSNYRSVTTLHPSPISGTVVVESYVVDVPPGNTKEETCDFVDVIVRCNLQSLAKIAENTAAESKKKMSL DIP protein O80920 original sequence version: 50 DIP protein O80920 original sequence version: 54 DIP protein O80920 original sequence version: 68 118160B35D7066BB c17-hab1-1 5 10 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 7 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction pyl4-hab1-1 1 11 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 10 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction c17-abi1-1 6 9 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 7 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction pyl4-abi1-1 4 9 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 11 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction c17-pp2ca-1 2 8 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 7 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction pyl4-pp2ca-1 3 8 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 11 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction