DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Structural basis of response regulator dephosphorylation by Rap phosphatases. Structural basis of response regulator dephosphorylation by Rap phosphatases. PLoS biology 2011 imex curation Parashar V., Mirouze N., Dubnau DA., Neiditch MB. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Parashar V., Mirouze N., Dubnau DA., Neiditch MB. DIP original experiment: DIP-216759X PLoS biology 2011 IMEx Structural basis of response regulator dephosphorylation by Rap phosphatases. Structural basis of response regulator dephosphorylation by Rap phosphatases. Structural basis of response regulator dephosphorylation by Rap phosphatases. PLoS biology 2011 imex curation Parashar V., Mirouze N., Dubnau DA., Neiditch MB. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Parashar V., Mirouze N., Dubnau DA., Neiditch MB. DIP original experiment: DIP-216762X PLoS biology 2011 IMEx Structural basis of response regulator dephosphorylation by Rap phosphatases. Structural basis of response regulator dephosphorylation by Rap phosphatases. Structural basis of response regulator dephosphorylation by Rap phosphatases. PLoS biology 2011 imex curation Parashar V., Mirouze N., Dubnau DA., Neiditch MB. Only protein-protein interactions in vitro In vitro protein phosphatase assay protein phosphatase assay predetermined predetermined participant predetermined Parashar V., Mirouze N., Dubnau DA., Neiditch MB. DIP original experiment: DIP-216763X PLoS biology 2011 IMEx Structural basis of response regulator dephosphorylation by Rap phosphatases. Structural basis of response regulator dephosphorylation by Rap phosphatases. Structural basis of response regulator dephosphorylation by Rap phosphatases. PLoS biology 2011 imex curation Parashar V., Mirouze N., Dubnau DA., Neiditch MB. Only protein-protein interactions in vitro In vitro protein phosphatase assay protein phosphatase assay autoradiography autoradiography Parashar V., Mirouze N., Dubnau DA., Neiditch MB. DIP original experiment: DIP-216760X PLoS biology 2011 IMEx Structural basis of response regulator dephosphorylation by Rap phosphatases. Structural basis of response regulator dephosphorylation by Rap phosphatases. Structural basis of response regulator dephosphorylation by Rap phosphatases. PLoS biology 2011 imex curation Parashar V., Mirouze N., Dubnau DA., Neiditch MB. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Parashar V., Mirouze N., Dubnau DA., Neiditch MB. DIP original experiment: DIP-216758X PLoS biology 2011 IMEx Structural basis of response regulator dephosphorylation by Rap phosphatases. Structural basis of response regulator dephosphorylation by Rap phosphatases. Structural basis of response regulator dephosphorylation by Rap phosphatases. PLoS biology 2011 imex curation Parashar V., Mirouze N., Dubnau DA., Neiditch MB. Only protein-protein interactions in vitro In vitro protein kinase assay protein kinase assay predetermined predetermined participant predetermined Parashar V., Mirouze N., Dubnau DA., Neiditch MB. DIP original experiment: DIP-216761X PLoS biology 2011 IMEx Structural basis of response regulator dephosphorylation by Rap phosphatases. sp0f_bacsu Sporulation initiation phosphotransferase F spo0F Stage 0 sporulation protein F BSU37130 protein protein bacsu Bacillus subtilis MMNEKILIVDDQYGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERPDLVLLDMKIPGMDGIEILKRMKVIDENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYLPLKSN 4130377E3558D698 4130377E3558D698 rapj_bacsu Response regulator aspartate phosphatase J ycdE BSU02820 rapJ protein protein bacsu Bacillus subtilis MRAKIPSEEVAVKLNEWYKLIRAFEADQAEALKQEIEYDLEDMEENQDLLLYFSLMEFRHRIMLDKLMPVKDSDTKPPFSDMLNEIESNQQKLTGLLEYYFYYFRGMYEFKQKNFILAIDHYKHAEEKLEYVEDEIEKAEFLFKVAEVYYHIKQTYFSMNYASQALDIYTKYELYGRRRVQCEFIIAGNLTDVYHHEKALTHLCSALEHARQLEEAYMIAAAYYNVGHCKYSLGDYKEAEGYFKTAAAIFEEHNFQQAVQAVFSLTHIYCKEGKYDKAVEAYDRGIKSAAEWEDDMYLTKFRLIHELYLGSGDLNVLTECFDLLESRQLLADAEDLLHDTAERFNQLEHYESAAFFYRRLMNIKKKLAEQRFQ E5EC939CE2B6E1DC E5EC939CE2B6E1DC kina_bacsu Sporulation kinase A kinA Stage II sporulation protein F Stage II sporulation protein J gsiC scoD spoIIF spoIIJ BSU13990 protein protein bacsu Bacillus subtilis MEQDTQHVKPLQTKTDIHAVLASNGRIIYISANSKLHLGYLQGEMIGSFLKTFLHEEDQFLVESYFYNEHHLMPCTFRFIKKDHTIVWVEAAVEIVTTRAERTEREIILKMKVLEEETGHQSLNCEKHEIEPASPESTTYITDDYERLVENLPSPLCISVKGKIVYVNSAMLSMLGAKSKDAIIGKSSYEFIEEEYHDIVKNRIIRMQKGMEVGMIEQTWKRLDGTPVHLEVKASPTVYKNQQAELLLLIDISSRKKFQTILQKSRERYQLLIQNSIDTIAVIHNGKWVFMNESGISLFEAATYEDLIGKNIYDQLHPCDHEDVKERIQNIAEQKTESEIVKQSWFTFQNRVIYTEMVCIPTTFFGEAAVQVILRDISERKQTEELMLKSEKLSIAGQLAAGIAHEIRNPLTAIKGFLQLMKPTMEGNEHYFDIVFSELSRIELILSELLMLAKPQQNAVKEYLNLKKLIGEVSALLETQANLNGIFIRTSYEKDSIYINGDQNQLKQVFINLIKNAVESMPDGGTVDIIITEDEHSVHVTVKDEGEGIPEKVLNRIGEPFLTTKEKGTGLGLMVTFNIIENHQGVIHVDSHPEKGTAFKISFPKK A8BB97FE844B32EE A8BB97FE844B32EE raph_bacsu Response regulator aspartate phosphatase H rapH PSP28 yeeH yzqA BSU06830 protein protein bacsu Bacillus subtilis MSQAIPSSRVGVKINEWYKMIRQFSVPDAEILKAEVEQDIQQMEEDQDLLIYYSLMCFRHQLMLDYLEPGKTYGNRPTVTELLETIETPQKKLTGLLKYYSLFFRGMYEFDQKEYVEAIGYYREAEKELPFVSDDIEKAEFHFKVAEAYYHMKQTHVSMYHILQALDIYQNHPLYSIRTIQSLFVIAGNYDDFKHYDKALPHLEAALELAMDIQNDRFIAISLLNIANSYDRSGDDQMAVEHFQKAAKVSREKVPDLLPKVLFGLSWTLCKAGQTQKAFQFIEEGLDHITARSHKFYKELFLFLQAVYKETVDERKIHDLLSYFEKKNLHAYIEACARSAAAVFESSCHFEQAAAFYRKVLKAQEDILKGECLYAY 74FABAA843676A74 rapj-spo0f-1 3 8 enzyme enzyme unspecified role unspecified role ecolx Escherichia coli 7 enzyme target enzyme target substrate substrate unspecified role unspecified role 32p-label 32p-label 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli dephosphorylation dephosphorylation reaction dephosphorylation raph-spo0f-1 5 10 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 7 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction raph-1 1 10 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction kina-spo0f-1 6 9 enzyme enzyme unspecified role unspecified role ecolx Escherichia coli 7 enzyme target enzyme target substrate substrate unspecified role unspecified role ecolx Escherichia coli phosphorylation phosphorylation reaction phosphorylation raph-spo0f-2 4 10 enzyme enzyme unspecified role unspecified role Q59HN8:p.Gln47Asn Q47N mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Q N This feature has been corrected as a result of our quality control procedures. The original label was 'Q47N'. Wed May 02 19:37:48 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln47asn' Tue Jun 30 20:15:03 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln47Asn' Q59HN8:p.Leu50Ala L50A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L A This feature has been corrected as a result of our quality control procedures. The original label was 'L50A'. Wed May 02 16:55:42 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu50ala' Tue Jun 30 17:12:40 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu50Ala' Q59HN8:p.Phe58Ala F58A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain F A This feature has been corrected as a result of our quality control procedures. The original label was 'F58A'. Wed May 02 19:23:01 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe58ala' Tue Jun 30 17:52:23 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe58Ala' Q59HN8:p.Asp134Ala D134A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain D A This feature has been corrected as a result of our quality control procedures. The original label was 'D134A'. Wed May 02 19:46:35 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp134ala' Tue Jun 30 16:29:54 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp134Ala' Q59HN8:p.Tyr175Ala Y175A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Y A This feature has been corrected as a result of our quality control procedures. The original label was 'Y175A'. Wed May 02 18:23:07 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr175ala' Tue Jun 30 17:54:41 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr175Ala' Q59HN8:p.Glu137Ala E137A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain E A This feature has been corrected as a result of our quality control procedures. The original label was 'E137A'. Wed May 02 17:21:48 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu137ala' Tue Jun 30 16:57:51 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu137Ala' ecolx Escherichia coli 7 enzyme target enzyme target substrate substrate unspecified role unspecified role 32p-label 32p-label 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli dephosphorylation dephosphorylation reaction dephosphorylation rapj-1 2 8 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction