DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Cortisone-reductase deficiency associated with heterozygous mutations in 11beta-hydroxysteroid dehydrogenase type 1. Cortisone-reductase deficiency associated with heterozygous mutations in 11beta-hydroxysteroid dehydrogenase type 1. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Lawson AJ., Walker EA., Lavery GG., Bujalska IJ., Hughes B., Arlt W., Stewart PM., Ride JP. Only protein-protein interactions ecolx Escherichia coli pull down pull down anti tag western anti tag western blot anti tag western Lawson AJ., Walker EA., Lavery GG., Bujalska IJ., Hughes B., Arlt W., Stewart PM., Ride JP. DIP original experiment: DIP-249193X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Cortisone-reductase deficiency associated with heterozygous mutations in 11beta-hydroxysteroid dehydrogenase type 1. dhi1_human Corticosteroid 11-beta-dehydrogenase isozyme 1 HSD11B1 SDR26C1 Short chain dehydrogenase/reductase family 26C member 1 HSD11 HSD11L 11-beta-hydroxysteroid dehydrogenase 1 protein protein human Homo sapiens Human MAFMKKYLLPILGLFMAYYYYSANEEFRPEMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSITLCVLGLIDTETAMKAVSGIVHMQAAPKEECALEIIKGGALRQEEVYYDSSLWTTLLIRNPCRKILEFLYSTSYNMDRFINK DIP protein P28845 original sequence version: 128 4632D0F3BBEFC474 hsd11b1-hsd11b1-1 1 2 unspecified role unspecified role prey prey Region 24-292 Region 24-292 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Strep-tag Strep-tag strep tag strep tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 2 unspecified role unspecified role bait bait Region 24-292 Region 24-292 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli physical association physical association