DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Polarity proteins Bem1 and Cdc24 are components of the filamentous fungal NADPH oxidase complex. Polarity proteins Bem1 and Cdc24 are components of the filamentous fungal NADPH oxidase complex. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Takemoto D., Kamakura S., Saikia S., Becker Y., Wrenn R., Tanaka A., Sumimoto H., Scott B. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Takemoto D., Kamakura S., Saikia S., Becker Y., Wrenn R., Tanaka A., Sumimoto H., Scott B. DIP original experiment: DIP-249155X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Polarity proteins Bem1 and Cdc24 are components of the filamentous fungal NADPH oxidase complex. Polarity proteins Bem1 and Cdc24 are components of the filamentous fungal NADPH oxidase complex. Polarity proteins Bem1 and Cdc24 are components of the filamentous fungal NADPH oxidase complex. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Takemoto D., Kamakura S., Saikia S., Becker Y., Wrenn R., Tanaka A., Sumimoto H., Scott B. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Takemoto D., Kamakura S., Saikia S., Becker Y., Wrenn R., Tanaka A., Sumimoto H., Scott B. DIP original experiment: DIP-249154X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Polarity proteins Bem1 and Cdc24 are components of the filamentous fungal NADPH oxidase complex. Polarity proteins Bem1 and Cdc24 are components of the filamentous fungal NADPH oxidase complex. Polarity proteins Bem1 and Cdc24 are components of the filamentous fungal NADPH oxidase complex. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Takemoto D., Kamakura S., Saikia S., Becker Y., Wrenn R., Tanaka A., Sumimoto H., Scott B. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Takemoto D., Kamakura S., Saikia S., Becker Y., Wrenn R., Tanaka A., Sumimoto H., Scott B. DIP original experiment: DIP-249157X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Polarity proteins Bem1 and Cdc24 are components of the filamentous fungal NADPH oxidase complex. Polarity proteins Bem1 and Cdc24 are components of the filamentous fungal NADPH oxidase complex. Polarity proteins Bem1 and Cdc24 are components of the filamentous fungal NADPH oxidase complex. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Takemoto D., Kamakura S., Saikia S., Becker Y., Wrenn R., Tanaka A., Sumimoto H., Scott B. Only protein-protein interactions epichloe festucae Epichloe festucae bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Takemoto D., Kamakura S., Saikia S., Becker Y., Wrenn R., Tanaka A., Sumimoto H., Scott B. DIP original experiment: DIP-249145X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Polarity proteins Bem1 and Cdc24 are components of the filamentous fungal NADPH oxidase complex. Polarity proteins Bem1 and Cdc24 are components of the filamentous fungal NADPH oxidase complex. Polarity proteins Bem1 and Cdc24 are components of the filamentous fungal NADPH oxidase complex. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Takemoto D., Kamakura S., Saikia S., Becker Y., Wrenn R., Tanaka A., Sumimoto H., Scott B. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Takemoto D., Kamakura S., Saikia S., Becker Y., Wrenn R., Tanaka A., Sumimoto H., Scott B. DIP original experiment: DIP-249156X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Polarity proteins Bem1 and Cdc24 are components of the filamentous fungal NADPH oxidase complex. Polarity proteins Bem1 and Cdc24 are components of the filamentous fungal NADPH oxidase complex. Polarity proteins Bem1 and Cdc24 are components of the filamentous fungal NADPH oxidase complex. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Takemoto D., Kamakura S., Saikia S., Becker Y., Wrenn R., Tanaka A., Sumimoto H., Scott B. Only protein-protein interactions epichloe festucae Epichloe festucae bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Takemoto D., Kamakura S., Saikia S., Becker Y., Wrenn R., Tanaka A., Sumimoto H., Scott B. DIP original experiment: DIP-249144X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Polarity proteins Bem1 and Cdc24 are components of the filamentous fungal NADPH oxidase complex. Polarity proteins Bem1 and Cdc24 are components of the filamentous fungal NADPH oxidase complex. Polarity proteins Bem1 and Cdc24 are components of the filamentous fungal NADPH oxidase complex. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Takemoto D., Kamakura S., Saikia S., Becker Y., Wrenn R., Tanaka A., Sumimoto H., Scott B. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Takemoto D., Kamakura S., Saikia S., Becker Y., Wrenn R., Tanaka A., Sumimoto H., Scott B. DIP original experiment: DIP-249153X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Polarity proteins Bem1 and Cdc24 are components of the filamentous fungal NADPH oxidase complex. Polarity proteins Bem1 and Cdc24 are components of the filamentous fungal NADPH oxidase complex. Polarity proteins Bem1 and Cdc24 are components of the filamentous fungal NADPH oxidase complex. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Takemoto D., Kamakura S., Saikia S., Becker Y., Wrenn R., Tanaka A., Sumimoto H., Scott B. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Takemoto D., Kamakura S., Saikia S., Becker Y., Wrenn R., Tanaka A., Sumimoto H., Scott B. DIP original experiment: DIP-249147X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Polarity proteins Bem1 and Cdc24 are components of the filamentous fungal NADPH oxidase complex. Polarity proteins Bem1 and Cdc24 are components of the filamentous fungal NADPH oxidase complex. Polarity proteins Bem1 and Cdc24 are components of the filamentous fungal NADPH oxidase complex. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Takemoto D., Kamakura S., Saikia S., Becker Y., Wrenn R., Tanaka A., Sumimoto H., Scott B. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Takemoto D., Kamakura S., Saikia S., Becker Y., Wrenn R., Tanaka A., Sumimoto H., Scott B. DIP original experiment: DIP-249158X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Polarity proteins Bem1 and Cdc24 are components of the filamentous fungal NADPH oxidase complex. Polarity proteins Bem1 and Cdc24 are components of the filamentous fungal NADPH oxidase complex. Polarity proteins Bem1 and Cdc24 are components of the filamentous fungal NADPH oxidase complex. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Takemoto D., Kamakura S., Saikia S., Becker Y., Wrenn R., Tanaka A., Sumimoto H., Scott B. Only protein-protein interactions epichloe festucae Epichloe festucae bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Takemoto D., Kamakura S., Saikia S., Becker Y., Wrenn R., Tanaka A., Sumimoto H., Scott B. DIP original experiment: DIP-249142X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Polarity proteins Bem1 and Cdc24 are components of the filamentous fungal NADPH oxidase complex. Polarity proteins Bem1 and Cdc24 are components of the filamentous fungal NADPH oxidase complex. Polarity proteins Bem1 and Cdc24 are components of the filamentous fungal NADPH oxidase complex. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Takemoto D., Kamakura S., Saikia S., Becker Y., Wrenn R., Tanaka A., Sumimoto H., Scott B. Only protein-protein interactions chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Takemoto D., Kamakura S., Saikia S., Becker Y., Wrenn R., Tanaka A., Sumimoto H., Scott B. DIP original experiment: DIP-249141X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Polarity proteins Bem1 and Cdc24 are components of the filamentous fungal NADPH oxidase complex. Polarity proteins Bem1 and Cdc24 are components of the filamentous fungal NADPH oxidase complex. Polarity proteins Bem1 and Cdc24 are components of the filamentous fungal NADPH oxidase complex. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Takemoto D., Kamakura S., Saikia S., Becker Y., Wrenn R., Tanaka A., Sumimoto H., Scott B. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Takemoto D., Kamakura S., Saikia S., Becker Y., Wrenn R., Tanaka A., Sumimoto H., Scott B. DIP original experiment: DIP-249150X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Polarity proteins Bem1 and Cdc24 are components of the filamentous fungal NADPH oxidase complex. Polarity proteins Bem1 and Cdc24 are components of the filamentous fungal NADPH oxidase complex. Polarity proteins Bem1 and Cdc24 are components of the filamentous fungal NADPH oxidase complex. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Takemoto D., Kamakura S., Saikia S., Becker Y., Wrenn R., Tanaka A., Sumimoto H., Scott B. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Takemoto D., Kamakura S., Saikia S., Becker Y., Wrenn R., Tanaka A., Sumimoto H., Scott B. DIP original experiment: DIP-249149X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Polarity proteins Bem1 and Cdc24 are components of the filamentous fungal NADPH oxidase complex. Polarity proteins Bem1 and Cdc24 are components of the filamentous fungal NADPH oxidase complex. Polarity proteins Bem1 and Cdc24 are components of the filamentous fungal NADPH oxidase complex. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Takemoto D., Kamakura S., Saikia S., Becker Y., Wrenn R., Tanaka A., Sumimoto H., Scott B. Only protein-protein interactions chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Takemoto D., Kamakura S., Saikia S., Becker Y., Wrenn R., Tanaka A., Sumimoto H., Scott B. DIP original experiment: DIP-249139X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Polarity proteins Bem1 and Cdc24 are components of the filamentous fungal NADPH oxidase complex. Polarity proteins Bem1 and Cdc24 are components of the filamentous fungal NADPH oxidase complex. Polarity proteins Bem1 and Cdc24 are components of the filamentous fungal NADPH oxidase complex. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Takemoto D., Kamakura S., Saikia S., Becker Y., Wrenn R., Tanaka A., Sumimoto H., Scott B. Only protein-protein interactions epichloe festucae Epichloe festucae bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Takemoto D., Kamakura S., Saikia S., Becker Y., Wrenn R., Tanaka A., Sumimoto H., Scott B. DIP original experiment: DIP-249143X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Polarity proteins Bem1 and Cdc24 are components of the filamentous fungal NADPH oxidase complex. Polarity proteins Bem1 and Cdc24 are components of the filamentous fungal NADPH oxidase complex. Polarity proteins Bem1 and Cdc24 are components of the filamentous fungal NADPH oxidase complex. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Takemoto D., Kamakura S., Saikia S., Becker Y., Wrenn R., Tanaka A., Sumimoto H., Scott B. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Takemoto D., Kamakura S., Saikia S., Becker Y., Wrenn R., Tanaka A., Sumimoto H., Scott B. DIP original experiment: DIP-249151X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Polarity proteins Bem1 and Cdc24 are components of the filamentous fungal NADPH oxidase complex. Polarity proteins Bem1 and Cdc24 are components of the filamentous fungal NADPH oxidase complex. Polarity proteins Bem1 and Cdc24 are components of the filamentous fungal NADPH oxidase complex. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Takemoto D., Kamakura S., Saikia S., Becker Y., Wrenn R., Tanaka A., Sumimoto H., Scott B. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Takemoto D., Kamakura S., Saikia S., Becker Y., Wrenn R., Tanaka A., Sumimoto H., Scott B. DIP original experiment: DIP-249159X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Polarity proteins Bem1 and Cdc24 are components of the filamentous fungal NADPH oxidase complex. Polarity proteins Bem1 and Cdc24 are components of the filamentous fungal NADPH oxidase complex. Polarity proteins Bem1 and Cdc24 are components of the filamentous fungal NADPH oxidase complex. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Takemoto D., Kamakura S., Saikia S., Becker Y., Wrenn R., Tanaka A., Sumimoto H., Scott B. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Takemoto D., Kamakura S., Saikia S., Becker Y., Wrenn R., Tanaka A., Sumimoto H., Scott B. DIP original experiment: DIP-249152X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Polarity proteins Bem1 and Cdc24 are components of the filamentous fungal NADPH oxidase complex. Polarity proteins Bem1 and Cdc24 are components of the filamentous fungal NADPH oxidase complex. Polarity proteins Bem1 and Cdc24 are components of the filamentous fungal NADPH oxidase complex. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Takemoto D., Kamakura S., Saikia S., Becker Y., Wrenn R., Tanaka A., Sumimoto H., Scott B. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Takemoto D., Kamakura S., Saikia S., Becker Y., Wrenn R., Tanaka A., Sumimoto H., Scott B. DIP original experiment: DIP-249146X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Polarity proteins Bem1 and Cdc24 are components of the filamentous fungal NADPH oxidase complex. Polarity proteins Bem1 and Cdc24 are components of the filamentous fungal NADPH oxidase complex. Polarity proteins Bem1 and Cdc24 are components of the filamentous fungal NADPH oxidase complex. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Takemoto D., Kamakura S., Saikia S., Becker Y., Wrenn R., Tanaka A., Sumimoto H., Scott B. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Takemoto D., Kamakura S., Saikia S., Becker Y., Wrenn R., Tanaka A., Sumimoto H., Scott B. DIP original experiment: DIP-249148X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Polarity proteins Bem1 and Cdc24 are components of the filamentous fungal NADPH oxidase complex. Polarity proteins Bem1 and Cdc24 are components of the filamentous fungal NADPH oxidase complex. Polarity proteins Bem1 and Cdc24 are components of the filamentous fungal NADPH oxidase complex. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Takemoto D., Kamakura S., Saikia S., Becker Y., Wrenn R., Tanaka A., Sumimoto H., Scott B. Only protein-protein interactions chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Takemoto D., Kamakura S., Saikia S., Becker Y., Wrenn R., Tanaka A., Sumimoto H., Scott B. DIP original experiment: DIP-249140X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Polarity proteins Bem1 and Cdc24 are components of the filamentous fungal NADPH oxidase complex. d1myr7_9hypo BemA protein protein epichloe festucae Epichloe festucae MTLIQALRRSIKGDKKEQHHTSLGTKSAVAIIPPKKVIRALYDYEAQSSQELSFSKGDFFHVIGRENDEDWYEACNPALPDARGLVPVSFFQALGRTERDSAQSDGGRPPTAKSPDHDSGYSEHSPHPIATAMPISHRSTKSTDIDNKIFAIVMYDFEAQRADELGATKGEQIIIIAQSTAEWFVAKPIARLGGPGLIPVSYVEIRSVKTREVVPNALEAVRKAGVPSVEEWKKMAASYKNSSITLGKFEGGAGPGGGGGQQGIEQGMDRMSLQTGRQSAQNGSQPRAGQNNNVSQSNQFAPSQSTPQLYAPTRAWIPRYCFAEDKYWFVIVAVLDDGRHWELSRYYEDFYDFQIALLTEFPAEAGNAGGQKRTLPYMPGPVSYVTDAITEGRLHNLDAYVKNLLNQPEYISRCNLVKQFFAPREGDYEVDPNETEQEYRLSQGSQQSAESPGNNGSRSNLNGNGYAGHSATPRQTSNSQQGMPSQQQGGQAPQMKVKMYFNGDLIAIRVPSAADYQQLCDKVRERLKISQDDQLQLFYKDEPTGNKPSLMSDGDLDFALQRNEKLVLYVEVV DIP protein D1MYR7 original sequence version: 11 a0jc82_9hypo noxR protein protein epichloe festucae Epichloe festucae MSLKLEIETWVAALARYDNNEFDDALGEFDKICDTSKILFNMGVIHATLGEHEKAVECYQRAIRLDQYLAVAYFQQGVSNFLLGDFEEALANFNDTLLYLRGNTMIDYAQLGLLFKLYSCEVLFNRGLCYIYLQQQDVGMQDLTYAVKEKVVEDHNVIDEAIREEAEGYTVFSIPVGVVYRPNEAKVRNLKTKDYLGKARLVAASDRSNAFTGFTGSEIKNAGKMEVKDDRPADNISFAATNLVKPGIQSRRQQPEPSANRNVFPPTPPPDNDRPSRGSSVRNGSRPMPAKLTIQTQDSNRKYEKAPSPEEVRATRSAASSTPSQGFSRRDHPPIQRRPTRRIDEMEEADAGDLYDMYQGSGSNRRTSRDSRRPSVRSRTQPRYYDDDDGSDYDDGSLDGAEFEMVSNNRRRQGSRSESRATSRRPEIRKIRVKVHAGDVRYIMIGAAIEYPDFVDRIKDKFGMKRRFKIKIPDEDMPDGDMITVGDQDDLEMAIQSSTSLAKRQRQDVAKMEIWIFEL DIP protein A0JC82 original sequence version: 18 d1myr8_9hypo Cdc24 protein protein epichloe festucae Epichloe festucae MAHAPLLRNNTAPVFQSNQSGFKNITQAKTMSSAPRGSQLSGSTAYAGSSTSLSSLASAATVVPGQNGGPIMATTNIINQKADASRSLYQICVSLKQRLSQVPDFTPFLEQLDPSDPVDPLWNLLRTGYPLLTIYNSLQPTEPLKVEDQIASEAKKSKIAIFKFVQACMKELQVPPAQSFVITDLMGNDTSGFVKVTQVVNYVLDLADQRGLLLQLQPYPEDEPAATTGSAQMSYRDHIVKELVDTERKYVQDLENLHDLKKTLEQKGLIPGDIVHQIFLNINAILDFQRRFLIRVETTNSMPKAVQRWGAPFCFYEDAFDIYQPFIANQRKAAQIANIVFDKIQQSGHPVATDFNTLDGFLLKPMQRLVKYPLLLKDLAKKSDDPQVKDDLCTGCEAAERVLQKANEAVNRDLLDEALEELITRVDDWKSHKVESFGKLLLHGVYGVITGKSDQEKEYEIYLFECILLCCKESSGKKDKTRSTGPKIKNRNGKLQLKGRIFMTNVTDVVSLSKPGSHSVQIWWRGDPGVENFTIKFLNEEMMRKWAVGLETQRKENAPRHSQSQESISNDFAWTRDHAGGLENPYLSQQEDDEEDHGPATAPTQYPVPRTSSSGNLRQRSATGDSTQSLAGIARAPPPRFPMPIPPASLSLQTQSSGAQSPSSRGGDSYFSPVAESPASSRTSTASGIFPGPAYQFPPKAGTPQSVWDDPRYAPGAMPRAPSRDGSSSSNTHGMAGGGRNARGPSLPAMATHSQTAAQQQQQQQRSRSYSTPDVNGAGISRQRQPSQSNIPAVPGIPQHLHPAHDGNIPRSQTGSPRNDLPIRTSTQSPGAQRERMHQHSGSLGGAMSHFATQPLYSRGNTPGPTGGDLLRVDSAAANSRNASPSIGTGSLTSTGNPLATPDLPMPTQLKVRVNCDSGNYVTLVVAFNITYQSLIDRIDAKLARFMTSSIGKGTLKLRYRDEDGDSVTIESDDDIQIAFMEWREGVRNMYSGGVGEIELFCVGEGQ DIP protein D1MYR8 original sequence version: 9 cdc24-bema-1 5 22 unspecified role unspecified role prey prey PB1 domain Region 488-573 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain D1MYR7:p.Lys498Ala K498A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain K A This feature has been corrected as a result of our quality control procedures. The original label was 'K498A'. Wed May 02 16:39:48 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys498ala' Tue Jun 30 16:02:23 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys498Ala' yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 24 unspecified role unspecified role bait bait PB1 domain Region 905-1007 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction noxr-cdc24-1 14 24 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey 23 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey physical association physical association noxr-cdc24-2 18 24 unspecified role unspecified role prey prey PB1 domain Region 905-1007 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 23 unspecified role unspecified role bait bait PB1 domain Region 424-519 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain A0JC82:p.Lys434Ala K434A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain K A This feature has been corrected as a result of our quality control procedures. The original label was 'K434A'. Wed May 02 16:56:42 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys434ala' Tue Jun 30 19:45:32 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys434Ala' yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction bema-noxr-1 15 22 unspecified role unspecified role unspecified role unspecified role C-terminal domain of GFP cGFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range epichloe festucae Epichloe festucae 23 unspecified role unspecified role unspecified role unspecified role N-terminal domain of GFP nGFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range epichloe festucae Epichloe festucae physical association physical association noxr-bema-1 8 23 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 22 unspecified role unspecified role prey prey Δ495-573 Δ495-573 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction bema-cdc24-1 7 22 unspecified role unspecified role bait bait PB1 domain Region 488-573 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 24 unspecified role unspecified role prey prey PB1 domain Region 905-1007 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction noxr-bema-2 21 22 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey 23 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey physical association physical association cdc24-noxr-1 13 24 unspecified role unspecified role bait bait Δ910-1007 Δ910-1007 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 23 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction cdc24-noxr-2 17 24 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 23 unspecified role unspecified role prey prey Δ429-519 Δ429-519 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction cdc24-noxr-3 6 24 unspecified role unspecified role unspecified role unspecified role N-terminal domain of GFP nGFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range epichloe festucae Epichloe festucae 23 unspecified role unspecified role unspecified role unspecified role C-terminal domain of GFP cGFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range epichloe festucae Epichloe festucae physical association physical association noxr-noxr-1 20 23 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 23 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction bema-cdc24-2 11 24 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey 22 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey physical association physical association noxr-bema-3 9 23 unspecified role unspecified role bait bait Region 1-428 Region 1-428 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Δ276-519 Δ276-519 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 22 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction noxr-noxr-2 12 23 unspecified role unspecified role prey prey PB1 domain Region 424-519 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 23 unspecified role unspecified role bait bait PB1 domain Region 424-519 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction cdc24-bema-2 2 22 unspecified role unspecified role prey prey PB1 domain Region 488-573 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 24 unspecified role unspecified role bait bait PB1 domain Region 905-1007 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain D1MYR8:p.Asp962Ala D962A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain D A This feature has been corrected as a result of our quality control procedures. The original label was 'D962A'. Wed May 02 19:42:38 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp962ala' Tue Jun 30 19:15:35 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp962Ala' yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction bema-cdc24-3 4 24 unspecified role unspecified role unspecified role unspecified role C-terminal domain of GFP cGFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range epichloe festucae Epichloe festucae 22 unspecified role unspecified role unspecified role unspecified role N-terminal domain of GFP nGFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range epichloe festucae Epichloe festucae physical association physical association noxr-noxr-3 10 23 unspecified role unspecified role unspecified role unspecified role C-terminal domain of GFP cGFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range epichloe festucae Epichloe festucae 23 unspecified role unspecified role unspecified role unspecified role N-terminal domain of GFP nGFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range epichloe festucae Epichloe festucae physical association physical association cdc24-noxr-4 16 24 unspecified role unspecified role bait bait PB1 domain Region 905-1007 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 23 unspecified role unspecified role prey prey PB1 domain Region 424-519 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction noxr-cdc24-3 1 24 unspecified role unspecified role prey prey PB1 domain Region 905-1007 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain D1MYR8:p.Asp962Ala D962A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain D A This feature has been corrected as a result of our quality control procedures. The original label was 'D962A'. Wed May 02 20:11:36 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp962ala' Tue Jun 30 17:47:54 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp962Ala' yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 23 unspecified role unspecified role bait bait PB1 domain Region 424-519 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction cdc24-bema-3 3 24 unspecified role unspecified role bait bait Δ910-1007 Δ910-1007 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 22 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction cdc24-bema-4 19 24 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 22 unspecified role unspecified role prey prey Region 1-494 Region 1-494 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Δ317-573 Δ317-573 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction