DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu The complex that inserts lipopolysaccharide into the bacterial outer membrane forms a two-protein plug-and-barrel. The complex that inserts lipopolysaccharide into the bacterial outer membrane forms a two-protein plug-and-barrel. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Freinkman E., Chng SS., Kahne D. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Freinkman E., Chng SS., Kahne D. DIP original experiment: DIP-253430X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx The complex that inserts lipopolysaccharide into the bacterial outer membrane forms a two-protein plug-and-barrel. The complex that inserts lipopolysaccharide into the bacterial outer membrane forms a two-protein plug-and-barrel. The complex that inserts lipopolysaccharide into the bacterial outer membrane forms a two-protein plug-and-barrel. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Freinkman E., Chng SS., Kahne D. Only protein-protein interactions ecolx Escherichia coli crosslink cross-linking study crosslink western blot western blot Immuno blot Immuno blot Freinkman E., Chng SS., Kahne D. DIP original experiment: DIP-253422X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx The complex that inserts lipopolysaccharide into the bacterial outer membrane forms a two-protein plug-and-barrel. The complex that inserts lipopolysaccharide into the bacterial outer membrane forms a two-protein plug-and-barrel. The complex that inserts lipopolysaccharide into the bacterial outer membrane forms a two-protein plug-and-barrel. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Freinkman E., Chng SS., Kahne D. Only protein-protein interactions ecolx Escherichia coli crosslink cross-linking study crosslink western blot western blot Immuno blot Immuno blot Freinkman E., Chng SS., Kahne D. DIP original experiment: DIP-253424X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx The complex that inserts lipopolysaccharide into the bacterial outer membrane forms a two-protein plug-and-barrel. The complex that inserts lipopolysaccharide into the bacterial outer membrane forms a two-protein plug-and-barrel. The complex that inserts lipopolysaccharide into the bacterial outer membrane forms a two-protein plug-and-barrel. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Freinkman E., Chng SS., Kahne D. Only protein-protein interactions ecolx Escherichia coli crosslink cross-linking study crosslink western blot western blot Immuno blot Immuno blot Freinkman E., Chng SS., Kahne D. DIP original experiment: DIP-253429X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx The complex that inserts lipopolysaccharide into the bacterial outer membrane forms a two-protein plug-and-barrel. The complex that inserts lipopolysaccharide into the bacterial outer membrane forms a two-protein plug-and-barrel. The complex that inserts lipopolysaccharide into the bacterial outer membrane forms a two-protein plug-and-barrel. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Freinkman E., Chng SS., Kahne D. Only protein-protein interactions ecolx Escherichia coli crosslink cross-linking study crosslink western blot western blot Immuno blot Immuno blot Freinkman E., Chng SS., Kahne D. DIP original experiment: DIP-253425X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx The complex that inserts lipopolysaccharide into the bacterial outer membrane forms a two-protein plug-and-barrel. The complex that inserts lipopolysaccharide into the bacterial outer membrane forms a two-protein plug-and-barrel. The complex that inserts lipopolysaccharide into the bacterial outer membrane forms a two-protein plug-and-barrel. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Freinkman E., Chng SS., Kahne D. Only protein-protein interactions ecolx Escherichia coli crosslink cross-linking study crosslink western blot western blot Immuno blot Immuno blot Freinkman E., Chng SS., Kahne D. DIP original experiment: DIP-253421X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx The complex that inserts lipopolysaccharide into the bacterial outer membrane forms a two-protein plug-and-barrel. The complex that inserts lipopolysaccharide into the bacterial outer membrane forms a two-protein plug-and-barrel. The complex that inserts lipopolysaccharide into the bacterial outer membrane forms a two-protein plug-and-barrel. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Freinkman E., Chng SS., Kahne D. Only protein-protein interactions ecolx Escherichia coli crosslink cross-linking study crosslink western blot western blot Immuno blot Immuno blot Freinkman E., Chng SS., Kahne D. DIP original experiment: DIP-253428X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx The complex that inserts lipopolysaccharide into the bacterial outer membrane forms a two-protein plug-and-barrel. The complex that inserts lipopolysaccharide into the bacterial outer membrane forms a two-protein plug-and-barrel. The complex that inserts lipopolysaccharide into the bacterial outer membrane forms a two-protein plug-and-barrel. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Freinkman E., Chng SS., Kahne D. Only protein-protein interactions ecolx Escherichia coli crosslink cross-linking study crosslink western blot western blot Immuno blot Immuno blot Freinkman E., Chng SS., Kahne D. DIP original experiment: DIP-253423X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx The complex that inserts lipopolysaccharide into the bacterial outer membrane forms a two-protein plug-and-barrel. The complex that inserts lipopolysaccharide into the bacterial outer membrane forms a two-protein plug-and-barrel. The complex that inserts lipopolysaccharide into the bacterial outer membrane forms a two-protein plug-and-barrel. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Freinkman E., Chng SS., Kahne D. Only protein-protein interactions ecolx Escherichia coli pull down pull down western blot western blot Immuno blot Immuno blot Freinkman E., Chng SS., Kahne D. DIP original experiment: DIP-253427X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx The complex that inserts lipopolysaccharide into the bacterial outer membrane forms a two-protein plug-and-barrel. The complex that inserts lipopolysaccharide into the bacterial outer membrane forms a two-protein plug-and-barrel. The complex that inserts lipopolysaccharide into the bacterial outer membrane forms a two-protein plug-and-barrel. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Freinkman E., Chng SS., Kahne D. Only protein-protein interactions ecolx Escherichia coli crosslink cross-linking study crosslink western blot western blot Immuno blot Immuno blot Freinkman E., Chng SS., Kahne D. DIP original experiment: DIP-253426X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx The complex that inserts lipopolysaccharide into the bacterial outer membrane forms a two-protein plug-and-barrel. The complex that inserts lipopolysaccharide into the bacterial outer membrane forms a two-protein plug-and-barrel. The complex that inserts lipopolysaccharide into the bacterial outer membrane forms a two-protein plug-and-barrel. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Freinkman E., Chng SS., Kahne D. Only protein-protein interactions ecolx Escherichia coli pull down pull down western blot western blot Immuno blot Immuno blot Freinkman E., Chng SS., Kahne D. DIP original experiment: DIP-253420X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx The complex that inserts lipopolysaccharide into the bacterial outer membrane forms a two-protein plug-and-barrel. The complex that inserts lipopolysaccharide into the bacterial outer membrane forms a two-protein plug-and-barrel. The complex that inserts lipopolysaccharide into the bacterial outer membrane forms a two-protein plug-and-barrel. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Freinkman E., Chng SS., Kahne D. Only protein-protein interactions ecolx Escherichia coli bn-page blue native page bn-page predetermined predetermined participant predetermined Freinkman E., Chng SS., Kahne D. DIP original experiment: DIP-253431X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx The complex that inserts lipopolysaccharide into the bacterial outer membrane forms a two-protein plug-and-barrel. lptd_ecoli LPS-assembly protein LptD lptD ostA b0054 yabG Organic solvent tolerance protein JW0053 imp protein protein ecoli Escherichia coli (strain K12) MKKRIPTLLATMIATALYSQQGLAADLASQCMLGVPSYDRPLVQGDTNDLPVTINADHAKGDYPDDAVFTGSVDIMQGNSRLQADEVQLHQKEAPGQPEPVRTVDALGNVHYDDNQVILKGPKGWANLNTKDTNVWEGDYQMVGRQGRGKADLMKQRGENRYTILDNGSFTSCLPGSDTWSVVGSEIIHDREEQVAEIWNARFKVGPVPIFYSPYLQLPVGDKRRSGFLIPNAKYTTTNYFEFYLPYYWNIAPNMDATITPHYMHRRGNIMWENEFRYLSQAGAGLMELDYLPSDKVYEDEHPNDDSSRRWLFYWNHSGVMDQVWRFNVDYTKVSDPSYFNDFDNKYGSSTDGYATQKFSVGYAVQNFNATVSTKQFQVFSEQNTSSYSAEPQLDVNYYQNDVGPFDTRIYGQAVHFVNTRDDMPEATRVHLEPTINLPLSNNWGSINTEAKLLATHYQQTNLDWYNSRNTTKLDESVNRVMPQFKVDGKMVFERDMEMLAPGYTQTLEPRAQYLYVPYRDQSDIYNYDSSLLQSDYSGLFRDRTYGGLDRIASANQVTTGVTSRIYDDAAVERFNISVGQIYYFTESRTGDDNITWENDDKTGSLVWAGDTYWRISERWGLRGGIQYDTRLDNVATSNSSIEYRRDEDRLVQLNYRYASPEYIQATLPKYYSTAEQYKNGISQVGAVASWPIADRWSIVGAYYYDTNANKQADSMLGVQYSSCCYAIRVGYERKLNGWDNDKQHAVYDNAIGFNIELRGLSSNYGLGTQEMLRSNILPYQNTL DIP protein P31554 original sequence version: 130 DIP protein P31554 original sequence version: 96 DIP protein P31554 original sequence version: 117 DIP protein P31554 original sequence version: null 906EA3FE8F8D3E1E lpte_ecoli LPS-assembly lipoprotein LptE lptE b0641 JW0636 Rare lipoprotein B rlpB protein protein ecoli Escherichia coli (strain K12) MRYLATLLLSLAVLITAGCGWHLRDTTQVPSTMKVMILDSGDPNGPLSRAVRNQLRLNGVELLDKETTRKDVPSLRLGKVSIAKDTASVFRNGQTAEYQMIMTVNATVLIPGRDIYPISAKVFRSFFDNPQMALAKDNEQDMIVKEMYDRAAEQLIRKLPSIRAADIRSDEEQTSTTTDTPATPARVSTTLGN DIP protein P0ADC1 original sequence version: 77 DIP protein P0ADC1 original sequence version: 42 DIP protein P0ADC1 original sequence version: 62 C9387BC2008ADEDC lptd-lpte-10 2 13 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 14 unspecified role unspecified role unspecified role unspecified role His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range pBPA pBPA modphe modified L-phenylalanine residue ModPhe certain certain sequence position certain certain certain sequence position certain pBPA pBPA cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction lpte-lptd-5 11 13 unspecified role unspecified role prey prey ecolx Escherichia coli 14 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecolx Escherichia coli physical association physical association lptd-lpte-11 3 13 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 14 unspecified role unspecified role unspecified role unspecified role His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range pBPA pBPA modphe modified L-phenylalanine residue ModPhe certain certain sequence position certain certain certain sequence position certain pBPA pBPA cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction lptd-lpte-12 7 13 unspecified role unspecified role unspecified role unspecified role pBPA pBPA modphe modified L-phenylalanine residue ModPhe certain certain sequence position certain certain certain sequence position certain pBPA pBPA cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 14 unspecified role unspecified role unspecified role unspecified role His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecolx Escherichia coli direct interaction direct interaction lptd-lpte-13 4 13 unspecified role unspecified role unspecified role unspecified role pBPA pBPA modphe modified L-phenylalanine residue ModPhe certain certain sequence position certain certain certain sequence position certain pBPA pBPA cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 14 unspecified role unspecified role unspecified role unspecified role His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecolx Escherichia coli direct interaction direct interaction lptd-lpte-14 10 13 unspecified role unspecified role unspecified role unspecified role S538 S538 xlnk-res-res crosslinked residues XLNK-Res-Res modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 14 unspecified role unspecified role unspecified role unspecified role His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range pBPA pBPA modphe modified L-phenylalanine residue ModPhe certain certain sequence position certain certain certain sequence position certain pBPA pBPA cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction lptd-lpte-15 12 13 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 14 unspecified role unspecified role unspecified role unspecified role His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecolx Escherichia coli direct interaction direct interaction lptd-lpte-16 6 13 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 14 unspecified role unspecified role unspecified role unspecified role His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range pBPA pBPA modphe modified L-phenylalanine residue ModPhe certain certain sequence position certain certain certain sequence position certain pBPA pBPA cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction lptd-lpte-17 8 13 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 14 unspecified role unspecified role unspecified role unspecified role His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range pBPA pBPA modphe modified L-phenylalanine residue ModPhe certain certain sequence position certain certain certain sequence position certain pBPA pBPA cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction lpte-lptd-6 9 13 unspecified role unspecified role prey prey ecolx Escherichia coli 14 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecolx Escherichia coli physical association physical association Deletion of region 529-538 decreased the interaction rate/strength. lptd-lpte-18 1 13 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 14 unspecified role unspecified role unspecified role unspecified role His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecolx Escherichia coli direct interaction direct interaction lptd-lpte-19 5 13 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 14 unspecified role unspecified role unspecified role unspecified role His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range pBPA pBPA modphe modified L-phenylalanine residue ModPhe certain certain sequence position certain certain certain sequence position certain pBPA pBPA cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction