DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Phosphorylation of glutamyl-prolyl tRNA synthetase by cyclin-dependent kinase 5 dictates transcript-selective translational control. Phosphorylation of glutamyl-prolyl tRNA synthetase by cyclin-dependent kinase 5 dictates transcript-selective translational control. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Arif A., Jia J., Moodt RA., DiCorleto PE., Fox PL. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Arif A., Jia J., Moodt RA., DiCorleto PE., Fox PL. DIP original experiment: DIP-253364X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Phosphorylation of glutamyl-prolyl tRNA synthetase by cyclin-dependent kinase 5 dictates transcript-selective translational control. Phosphorylation of glutamyl-prolyl tRNA synthetase by cyclin-dependent kinase 5 dictates transcript-selective translational control. Phosphorylation of glutamyl-prolyl tRNA synthetase by cyclin-dependent kinase 5 dictates transcript-selective translational control. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Arif A., Jia J., Moodt RA., DiCorleto PE., Fox PL. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Arif A., Jia J., Moodt RA., DiCorleto PE., Fox PL. DIP original experiment: DIP-253367X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Phosphorylation of glutamyl-prolyl tRNA synthetase by cyclin-dependent kinase 5 dictates transcript-selective translational control. Phosphorylation of glutamyl-prolyl tRNA synthetase by cyclin-dependent kinase 5 dictates transcript-selective translational control. Phosphorylation of glutamyl-prolyl tRNA synthetase by cyclin-dependent kinase 5 dictates transcript-selective translational control. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Arif A., Jia J., Moodt RA., DiCorleto PE., Fox PL. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Arif A., Jia J., Moodt RA., DiCorleto PE., Fox PL. DIP original experiment: DIP-253362X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Phosphorylation of glutamyl-prolyl tRNA synthetase by cyclin-dependent kinase 5 dictates transcript-selective translational control. Phosphorylation of glutamyl-prolyl tRNA synthetase by cyclin-dependent kinase 5 dictates transcript-selective translational control. Phosphorylation of glutamyl-prolyl tRNA synthetase by cyclin-dependent kinase 5 dictates transcript-selective translational control. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Arif A., Jia J., Moodt RA., DiCorleto PE., Fox PL. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Arif A., Jia J., Moodt RA., DiCorleto PE., Fox PL. DIP original experiment: DIP-253365X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Phosphorylation of glutamyl-prolyl tRNA synthetase by cyclin-dependent kinase 5 dictates transcript-selective translational control. Phosphorylation of glutamyl-prolyl tRNA synthetase by cyclin-dependent kinase 5 dictates transcript-selective translational control. Phosphorylation of glutamyl-prolyl tRNA synthetase by cyclin-dependent kinase 5 dictates transcript-selective translational control. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Arif A., Jia J., Moodt RA., DiCorleto PE., Fox PL. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Arif A., Jia J., Moodt RA., DiCorleto PE., Fox PL. DIP original experiment: DIP-253363X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Phosphorylation of glutamyl-prolyl tRNA synthetase by cyclin-dependent kinase 5 dictates transcript-selective translational control. Phosphorylation of glutamyl-prolyl tRNA synthetase by cyclin-dependent kinase 5 dictates transcript-selective translational control. Phosphorylation of glutamyl-prolyl tRNA synthetase by cyclin-dependent kinase 5 dictates transcript-selective translational control. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Arif A., Jia J., Moodt RA., DiCorleto PE., Fox PL. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Arif A., Jia J., Moodt RA., DiCorleto PE., Fox PL. DIP original experiment: DIP-253366X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Phosphorylation of glutamyl-prolyl tRNA synthetase by cyclin-dependent kinase 5 dictates transcript-selective translational control. hnrpq_human Heterogeneous nuclear ribonucleoprotein Q Synaptotagmin-binding, cytoplasmic RNA-interacting protein Glycine- and tyrosine-rich RNA-binding protein NS1-associated protein 1 SYNCRIP HNRPQ NSAP1 protein protein human Homo sapiens Human MATEHVNGNGTEEPMDTTSAVIHSENFQTLLDAGLPQKVAEKLDEIYVAGLVAHSDLDERAIEALKEFNEDGALAVLQQFKDSDLSHVQNKSAFLCGVMKTYRQREKQGTKVADSSKGPDEAKIKALLERTGYTLDVTTGQRKYGGPPPDSVYSGQQPSVGTEIFVGKIPRDLFEDELVPLFEKAGPIWDLRLMMDPLTGLNRGYAFVTFCTKEAAQEAVKLYNNHEIRSGKHIGVCISVANNRLFVGSIPKSKTKEQILEEFSKVTEGLTDVILYHQPDDKKKNRGFCFLEYEDHKTAAQARRRLMSGKVKVWGNVGTVEWADPIEDPDPEVMAKVKVLFVRNLANTVTEEILEKAFSQFGKLERVKKLKDYAFIHFDERDGAVKAMEEMNGKDLEGENIEIVFAKPPDQKRKERKAQRQAAKNQMYDDYYYYGPPHMPPPTRGRGRGGRGGYGYPPDYYGYEDYYDYYGYDYHNYRGGYEDPYYGYEDFQVGARGRGGRGARGAAPSRGRGAAPPRGRAGYSQRGGPGSARGVRGARGGAQQQRGRGVRGARGGRGGNVGGKRKADGYNQPDSKRRQTNNQNWGSQPIAQQPLQGGDHSGNYGYKSENQEFYQDTFGQQWK DIP protein O60506 original sequence version: 144 DIP protein O60506 original sequence version: 124 0669FA604E8FBBDF syep_human Bifunctional glutamate/proline--tRNA ligase EPRS1 Bifunctional aminoacyl-tRNA synthetase Cell proliferation-inducing gene 32 protein EPRS GLNS Glutamatyl-prolyl-tRNA synthetase PARS QARS QPRS PIG32 protein protein human Homo sapiens Human MATLSLTVNSGDPPLGALLAVEHVKDDVSISVEEGKENILHVSENVIFTDVNSILRYLARVATTAGLYGSNLMEHTEIDHWLEFSATKLSSCDSFTSTINELNHCLSLRTYLVGNSLSLADLCVWATLKGNAAWQEQLKQKKAPVHVKRWFGFLEAQQAFQSVGTKWDVSTTKARVAPEKKQDVGKFVELPGAEMGKVTVRFPPEASGYLHIGHAKAALLNQHYQVNFKGKLIMRFDDTNPEKEKEDFEKVILEDVAMLHIKPDQFTYTSDHFETIMKYAEKLIQEGKAYVDDTPAEQMKAEREQRIDSKHRKNPIEKNLQMWEEMKKGSQFGQSCCLRAKIDMSSNNGCMRDPTLYRCKIQPHPRTGNKYNVYPTYDFACPIVDSIEGVTHALRTTEYHDRDEQFYWIIEALGIRKPYIWEYSRLNLNNTVLSKRKLTWFVNEGLVDGWDDPRFPTVRGVLRRGMTVEGLKQFIAAQGSSRSVVNMEWDKIWAFNKKVIDPVAPRYVALLKKEVIPVNVPEAQEEMKEVAKHPKNPEVGLKPVWYSPKVFIEGADAETFSEGEMVTFINWGNLNITKIHKNADGKIISLDAKLNLENKDYKKTTKVTWLAETTHALPIPVICVTYEHLITKPVLGKDEDFKQYVNKNSKHEELMLGDPCLKDLKKGDIIQLQRRGFFICDQPYEPVSPYSCKEAPCVLIYIPDGHTKEMPTSGSKEKTKVEATKNETSAPFKERPTPSLNNNCTTSEDSLVLYNRVAVQGDVVRELKAKKAPKEDVDAAVKQLLSLKAEYKEKTGQEYKPGNPPAEIGQNISSNSSASILESKSLYDEVAAQGEVVRKLKAEKSPKAKINEAVECLLSLKAQYKEKTGKEYIPGQPPLSQSSDSSPTRNSEPAGLETPEAKVLFDKVASQGEVVRKLKTEKAPKDQVDIAVQELLQLKAQYKSLIGVEYKPVSATGAEDKDKKKKEKENKSEKQNKPQKQNDGQRKDPSKNQGGGLSSSGAGEGQGPKKQTRLGLEAKKEENLADWYSQVITKSEMIEYHDISGCYILRPWAYAIWEAIKDFFDAEIKKLGVENCYFPMFVSQSALEKEKTHVADFAPEVAWVTRSGKTELAEPIAIRPTSETVMYPAYAKWVQSHRDLPIKLNQWCNVVRWEFKHPQPFLRTREFLWQEGHSAFATMEEAAEEVLQILDLYAQVYEELLAIPVVKGRKTEKEKFAGGDYTTTIEAFISASGRAIQGGTSHHLGQNFSKMFEIVFEDPKIPGEKQFAYQNSWGLTTRTIGVMTMVHGDNMGLVLPPRVACVQVVIIPCGITNALSEEDKEALIAKCNDYRRRLLSVNIRVRADLRDNYSPGWKFNHWELKGVPIRLEVGPRDMKSCQFVAVRRDTGEKLTVAENEAETKLQAILEDIQVTLFTRASEDLKTHMVVANTMEDFQKILDSGKIVQIPFCGEIDCEDWIKKTTARDQDLEPGAPSMGAKSLCIPFKPLCELQPGAKCVCGKNPAKYYTLFGRSY DIP protein P07814 original sequence version: 204 DIP protein P07814 original sequence version: 155 DIP protein P07814 original sequence version: 159 DIP protein P07814 original sequence version: 122 2CE4311076719403 cd5r1_human Cyclin-dependent kinase 5 activator 1 Cyclin-dependent kinase 5 regulatory subunit 1 TPKII regulatory subunit CDK5R1 CDK5R NCK5A protein protein human Homo sapiens Human MGTVLSLSPSYRKATLFEDGAATVGHYTAVQNSKNAKDKNLKRHSIISVLPWKRIVAVSAKKKNSKKVQPNSSYQNNITHLNNENLKKSLSCANLSTFAQPPPAQPPAPPASQLSGSQTGGSSSVKKAPHPAVTSAGTPKRVIVQASTSELLRCLGEFLCRRCYRLKHLSPTDPVLWLRSVDRSLLLQGWQDQGFITPANVVFLYMLCRDVISSEVGSDHELQAVLLTCLYLSYSYMGNEISYPLKPFLVESCKEAFWDRCLSVINLMSSKMLQINADPHYFTQVFSDLKNESGQEDKKRLLLGLDR DIP protein Q15078 original sequence version: 119 DIP protein Q15078 original sequence version: 130 DIP protein Q15078 original sequence version: 109 D1C29A07AFF1B644 syk_human Lysine--tRNA ligase KARS1 KARS KIAA0070 Lysyl-tRNA synthetase protein protein human Homo sapiens Human MAAVQAAEVKVDGSEPKLSKNELKRRLKAEKKVAEKEAKQKELSEKQLSQATAAATNHTTDNGVGPEEESVDPNQYYKIRSQAIHQLKVNGEDPYPHKFHVDISLTDFIQKYSHLQPGDHLTDITLKVAGRIHAKRASGGKLIFYDLRGEGVKLQVMANSRNYKSEEEFIHINNKLRRGDIIGVQGNPGKTKKGELSIIPYEITLLSPCLHMLPHLHFGLKDKETRYRQRYLDLILNDFVRQKFIIRSKIITYIRSFLDELGFLEIETPMMNIIPGGAVAKPFITYHNELDMNLYMRIAPELYHKMLVVGGIDRVYEIGRQFRNEGIDLTHNPEFTTCEFYMAYADYHDLMEITEKMVSGMVKHITGSYKVTYHPDGPEGQAYDVDFTPPFRRINMVEELEKALGMKLPETNLFETEETRKILDDICVAKAVECPPPRTTARLLDKLVGEFLEVTCINPTFICDHPQIMSPLAKWHRSKEGLTERFELFVMKKEICNAYTELNDPMRQRQLFEEQAKAKAAGDDEAMFIDENFCTALEYGLPPTAGWGMGIDRVAMFLTDSNNIKEVLLFPAMKPEDKKENVATTDTLESTTVGTSV DIP protein Q15046 original sequence version: 69 DIP protein Q15046 original sequence version: 116 DIP protein Q15046-1 original sequence version: 124 DIP protein Q15046-1 original sequence version: 129 DIP protein Q15046 original sequence version: 129 E7770953332D905D cdk5_human Cyclin-dependent-like kinase 5 CDK5 Cell division protein kinase 5 Tau protein kinase II catalytic subunit Serine/threonine-protein kinase PSSALRE CDKN5 protein protein human Homo sapiens Human MQKYEKLEKIGEGTYGTVFKAKNRETHEIVALKRVRLDDDDEGVPSSALREICLLKELKHKNIVRLHDVLHSDKKLTLVFEFCDQDLKKYFDSCNGDLDPEIVKSFLFQLLKGLGFCHSRNVLHRDLKPQNLLINRNGELKLADFGLARAFGIPVRCYSAEVVTLWYRPPDVLFGAKLYSTSIDMWSAGCIFAELANAGRPLFPGNDVDDQLKRIFRLLGTPTEEQWPSMTKLPDYKPYPMYPATTSLVNVVPKLNATGRDLLQNLLKCNPVQRISAEEALQHPYFSDFCPP DIP protein Q00535 original sequence version: 129 DIP protein Q00535 original sequence version: 140 54D10495F017D527 cdk5-cdk5r1-11 3 9 unspecified role unspecified role prey prey human Homo sapiens Human 11 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association syncrip-eprs-1 2 7 unspecified role unspecified role bait bait human Homo sapiens Human 8 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association eprs-kars-1 4 7 unspecified role unspecified role prey prey human Homo sapiens Human 10 unspecified role unspecified role prey prey human Homo sapiens Human 8 unspecified role unspecified role bait bait human Homo sapiens Human association association cdk5-cdk5r1-12 5 8 unspecified role unspecified role prey prey human Homo sapiens Human 9 unspecified role unspecified role prey prey human Homo sapiens Human 11 unspecified role unspecified role bait bait human Homo sapiens Human association association kars-eprs-1 6 10 unspecified role unspecified role bait bait human Homo sapiens Human 8 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association eprs-kars-2 1 10 unspecified role unspecified role prey prey human Homo sapiens Human 8 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association