DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Phosphorylation of mouse immunity-related GTPase (IRG) resistance proteins is an evasion strategy for virulent Toxoplasma gondii. Phosphorylation of mouse immunity-related GTPase (IRG) resistance proteins is an evasion strategy for virulent Toxoplasma gondii. PLoS biology 2010 imex curation Steinfeldt T., Könen-Waisman S., Tong L., Pawlowski N., Lamkemeyer T., Sibley LD., Hunn JP., Howard JC. Only protein-protein interactions in vitro In vitro protein kinase assay protein kinase assay predetermined predetermined participant predetermined Steinfeldt T., Könen-Waisman S., Tong L., Pawlowski N., Lamkemeyer T., Sibley LD., Hunn JP., Howard JC. DIP original experiment: DIP-216742X PLoS biology 2010 IMEx Phosphorylation of mouse immunity-related GTPase (IRG) resistance proteins is an evasion strategy for virulent Toxoplasma gondii. Phosphorylation of mouse immunity-related GTPase (IRG) resistance proteins is an evasion strategy for virulent Toxoplasma gondii. Phosphorylation of mouse immunity-related GTPase (IRG) resistance proteins is an evasion strategy for virulent Toxoplasma gondii. PLoS biology 2010 imex curation Steinfeldt T., Könen-Waisman S., Tong L., Pawlowski N., Lamkemeyer T., Sibley LD., Hunn JP., Howard JC. Only protein-protein interactions in vitro In vitro light scattering light scattering predetermined predetermined participant predetermined Steinfeldt T., Könen-Waisman S., Tong L., Pawlowski N., Lamkemeyer T., Sibley LD., Hunn JP., Howard JC. DIP original experiment: DIP-216741X PLoS biology 2010 IMEx Phosphorylation of mouse immunity-related GTPase (IRG) resistance proteins is an evasion strategy for virulent Toxoplasma gondii. Phosphorylation of mouse immunity-related GTPase (IRG) resistance proteins is an evasion strategy for virulent Toxoplasma gondii. Phosphorylation of mouse immunity-related GTPase (IRG) resistance proteins is an evasion strategy for virulent Toxoplasma gondii. PLoS biology 2010 imex curation Steinfeldt T., Könen-Waisman S., Tong L., Pawlowski N., Lamkemeyer T., Sibley LD., Hunn JP., Howard JC. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Steinfeldt T., Könen-Waisman S., Tong L., Pawlowski N., Lamkemeyer T., Sibley LD., Hunn JP., Howard JC. DIP original experiment: DIP-216745X PLoS biology 2010 IMEx Phosphorylation of mouse immunity-related GTPase (IRG) resistance proteins is an evasion strategy for virulent Toxoplasma gondii. Phosphorylation of mouse immunity-related GTPase (IRG) resistance proteins is an evasion strategy for virulent Toxoplasma gondii. Phosphorylation of mouse immunity-related GTPase (IRG) resistance proteins is an evasion strategy for virulent Toxoplasma gondii. PLoS biology 2010 imex curation Steinfeldt T., Könen-Waisman S., Tong L., Pawlowski N., Lamkemeyer T., Sibley LD., Hunn JP., Howard JC. Only protein-protein interactions in vitro In vitro protein kinase assay protein kinase assay predetermined predetermined participant predetermined Steinfeldt T., Könen-Waisman S., Tong L., Pawlowski N., Lamkemeyer T., Sibley LD., Hunn JP., Howard JC. DIP original experiment: DIP-216743X PLoS biology 2010 IMEx Phosphorylation of mouse immunity-related GTPase (IRG) resistance proteins is an evasion strategy for virulent Toxoplasma gondii. Phosphorylation of mouse immunity-related GTPase (IRG) resistance proteins is an evasion strategy for virulent Toxoplasma gondii. Phosphorylation of mouse immunity-related GTPase (IRG) resistance proteins is an evasion strategy for virulent Toxoplasma gondii. PLoS biology 2010 imex curation Steinfeldt T., Könen-Waisman S., Tong L., Pawlowski N., Lamkemeyer T., Sibley LD., Hunn JP., Howard JC. Only protein-protein interactions in vitro In vitro protein kinase assay protein kinase assay weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Steinfeldt T., Könen-Waisman S., Tong L., Pawlowski N., Lamkemeyer T., Sibley LD., Hunn JP., Howard JC. DIP original experiment: DIP-216744X PLoS biology 2010 IMEx Phosphorylation of mouse immunity-related GTPase (IRG) resistance proteins is an evasion strategy for virulent Toxoplasma gondii. Phosphorylation of mouse immunity-related GTPase (IRG) resistance proteins is an evasion strategy for virulent Toxoplasma gondii. Phosphorylation of mouse immunity-related GTPase (IRG) resistance proteins is an evasion strategy for virulent Toxoplasma gondii. PLoS biology 2010 imex curation Steinfeldt T., Könen-Waisman S., Tong L., Pawlowski N., Lamkemeyer T., Sibley LD., Hunn JP., Howard JC. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Steinfeldt T., Könen-Waisman S., Tong L., Pawlowski N., Lamkemeyer T., Sibley LD., Hunn JP., Howard JC. DIP original experiment: DIP-216746X PLoS biology 2010 IMEx Phosphorylation of mouse immunity-related GTPase (IRG) resistance proteins is an evasion strategy for virulent Toxoplasma gondii. a1e140_toxgo ROP18 protein protein toxgo Toxoplasma gondii MLGRLIQPLTKHYHILQFCTHPSTVCVNVVMFSVQRPSLTCTVVRMGLATLLRKTACLAGLTVALVFLLFQVQDGTGITLRPSKLDSKPTISLDSQQHVANKRGSATVGHYKYSLAGATESTRDVSLLEERAQHGVNTQETNQRRTTFQRLVNRLRRRERDGAVSGFAADSPSRPRLSVRQRLAQLLRRAKSFFTHGIRRYYSQGRNRLRSWWAQRRRSGLVFEKADSGCVIGKRILAHMREQIRQPQALESSQRLDGILTAAAWPPDVPAKFVSLTTGETRTLVRGAPLGSGGFAAVYQVTDVETNEELAVKVIISEKKPTDETMRDLERESFCYKNFSLAKTAKDAQENWRFMVASDVVTLEGQPATTEVVIGSATKWVPNYFLLMMRAETDMSKVISWLFGDASVNNSELGLVVRMHLSSQAIRLVANVQAQGIVHTDIKPPNFLLLKDGRLFLGDFGTYKTNNSVGPAIGTPGYEPPEQPFHSYGVTYTFATDAWQLGITLYCIWCKESPTPADGIWDYLHFADCSSTPELVQDLIRNLLNREPQKRMLPLQALKTAAFNEMDSVVKRAAQNFEQQEHLQTE DIP protein A1E140 original sequence version: 28 iigp1_mouse Interferon-inducible GTPase 1 Iigp1 Irga6 protein protein mouse Mus musculus Mouse MGQLFSSPKSDENNDLPSSFTGYFKKFNTGRKIISQEILNLIELRMRKGNIQLTNSAISDALKEIDSSVLNVAVTGETGSGKSSFINTLRGIGNEEEGAAKTGVVEVTMERHPYKHPNIPNVVFWDLPGIGSTNFPPNTYLEKMKFYEYDFFIIISATRFKKNDIDIAKAISMMKKEFYFVRTKVDSDITNEADGKPQTFDKEKVLQDIRLNCVNTFRENGIAEPPIFLLSNKNVCHYDFPVLMDKLISDLPIYKRHNFMVSLPNITDSVIEKKRQFLKQRIWLEGFAADLVNIIPSLTFLLDSDLETLKKSMKFYRTVFGVDETSLQRLARDWEIEVDQVEAMIKSPAVFKPTDEETIQERLSRYIQEFCLANGYLLPKNSFLKEIFYLKYYFLDMVTEDAKTLLKEICLRN DIP protein Q9QZ85 original sequence version: 72 44B5A95FCA58A37A iigp1-rop18-1 4 7 enzyme enzyme unspecified role unspecified role ecolx Escherichia coli 8 enzyme target enzyme target substrate substrate unspecified role unspecified role Q9QZ85:p.[Thr102Ala;Thr108Ala] T102A/T108A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain T A certain certain sequence position certain certain certain sequence position certain T A This feature has been corrected as a result of our quality control procedures. The original label was 'T102A/T108A'. Wed May 02 15:35:39 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr102ala,thr108ala' Tue Jun 30 19:05:32 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Thr102Ala;Thr108Ala]' pT102 pT102 opthr O-phospho-L-threonine (2S,3R)-2-amino-3-(phosphonooxy)butanoic acid 2-amino-3-hydroxybutanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)butanoic acid MOD_RES Phosphothreonine O-phospho-L-threonine O-phosphorylated L-threonine O3-phosphothreonine threonine phosphate ester OPThr Phospho Phospho Threonyl Phosphorylation phosphorylationt western blot western blot Immuno blot Immuno blot certain certain sequence position certain certain certain sequence position certain pT108 pT108 opthr O-phospho-L-threonine (2S,3R)-2-amino-3-(phosphonooxy)butanoic acid 2-amino-3-hydroxybutanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)butanoic acid MOD_RES Phosphothreonine O-phospho-L-threonine O-phosphorylated L-threonine O3-phosphothreonine threonine phosphate ester OPThr Phospho Phospho Threonyl Phosphorylation phosphorylationt western blot western blot Immuno blot Immuno blot certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli phosphorylation phosphorylation reaction phosphorylation iigp1-1 2 8 unspecified role unspecified role unspecified role unspecified role Q9QZ85:p.Thr108Asp T108D mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain T D This feature has been corrected as a result of our quality control procedures. The original label was 'T108D'. Wed May 02 18:51:49 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr108asp' Tue Jun 30 19:59:02 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr108Asp' Q9QZ85:p.Thr102Ala T102A/D mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain T A Wed May 02 16:18:12 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr102ala' Tue Jun 30 20:08:19 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr102Ala' Q9QZ85:p.[Thr102Ala;Thr108Ala] T102A/D/T108A/D mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain T A certain certain sequence position certain certain certain sequence position certain T A Wed May 02 15:53:15 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr102ala,thr108ala' Tue Jun 30 18:32:50 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Thr102Ala;Thr108Ala]' Q9QZ85:p.Thr108Ala T108A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain T A This feature has been corrected as a result of our quality control procedures. The original label was 'T108A'. Wed May 02 17:45:58 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr108ala' Tue Jun 30 17:08:48 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr108Ala' Q9QZ85:p.Thr102Asp mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain T D Wed May 02 17:37:43 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr102asp' Tue Jun 30 16:44:26 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr102Asp' Q9QZ85:p.[Thr102Asp;Thr108Asp] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain T D certain certain sequence position certain certain certain sequence position certain T D Wed May 02 15:10:39 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr102asp,thr108asp' Tue Jun 30 17:07:13 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Thr102Asp;Thr108Asp]' ecolx Escherichia coli direct interaction direct interaction rop18-iigp1-1 6 7 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 8 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction iigp1-rop18-2 1 7 enzyme enzyme unspecified role unspecified role ecolx Escherichia coli 8 enzyme target enzyme target substrate substrate unspecified role unspecified role Q9QZ85:p.Thr108Ala T108A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain T A This feature has been corrected as a result of our quality control procedures. The original label was 'T108A'. Wed May 02 18:22:10 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr108ala' Tue Jun 30 19:21:24 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr108Ala' Q9QZ85:p.[Thr102Ala;Thr108Ala] T102A/T108A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain T A certain certain sequence position certain certain certain sequence position certain T A This feature has been corrected as a result of our quality control procedures. The original label was 'T102A/T108A'. Wed May 02 16:10:27 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr102ala,thr108ala' Tue Jun 30 16:48:15 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Thr102Ala;Thr108Ala]' ecolx Escherichia coli phosphorylation phosphorylation reaction phosphorylation rop18-1 5 7 putative self putative self unspecified role unspecified role ecolx Escherichia coli phosphorylation phosphorylation reaction phosphorylation true iigp1-iigp1-1 3 8 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 8 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction