DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Possible roles for Munc18-1 domain 3a and Syntaxin1 N-peptide and C-terminal anchor in SNARE complex formation. Possible roles for Munc18-1 domain 3a and Syntaxin1 N-peptide and C-terminal anchor in SNARE complex formation. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Hu SH., Christie MP., Saez NJ., Latham CF., Jarrott R., Lua LH., Collins BM., Martin JL. Only protein-protein interactions in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Hu SH., Christie MP., Saez NJ., Latham CF., Jarrott R., Lua LH., Collins BM., Martin JL. DIP original experiment: DIP-253353X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Possible roles for Munc18-1 domain 3a and Syntaxin1 N-peptide and C-terminal anchor in SNARE complex formation. Possible roles for Munc18-1 domain 3a and Syntaxin1 N-peptide and C-terminal anchor in SNARE complex formation. Possible roles for Munc18-1 domain 3a and Syntaxin1 N-peptide and C-terminal anchor in SNARE complex formation. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Hu SH., Christie MP., Saez NJ., Latham CF., Jarrott R., Lua LH., Collins BM., Martin JL. Only protein-protein interactions in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Hu SH., Christie MP., Saez NJ., Latham CF., Jarrott R., Lua LH., Collins BM., Martin JL. DIP original experiment: DIP-253354X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Possible roles for Munc18-1 domain 3a and Syntaxin1 N-peptide and C-terminal anchor in SNARE complex formation. Possible roles for Munc18-1 domain 3a and Syntaxin1 N-peptide and C-terminal anchor in SNARE complex formation. Possible roles for Munc18-1 domain 3a and Syntaxin1 N-peptide and C-terminal anchor in SNARE complex formation. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Hu SH., Christie MP., Saez NJ., Latham CF., Jarrott R., Lua LH., Collins BM., Martin JL. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Hu SH., Christie MP., Saez NJ., Latham CF., Jarrott R., Lua LH., Collins BM., Martin JL. DIP original experiment: DIP-253357X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Possible roles for Munc18-1 domain 3a and Syntaxin1 N-peptide and C-terminal anchor in SNARE complex formation. Possible roles for Munc18-1 domain 3a and Syntaxin1 N-peptide and C-terminal anchor in SNARE complex formation. Possible roles for Munc18-1 domain 3a and Syntaxin1 N-peptide and C-terminal anchor in SNARE complex formation. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Hu SH., Christie MP., Saez NJ., Latham CF., Jarrott R., Lua LH., Collins BM., Martin JL. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Hu SH., Christie MP., Saez NJ., Latham CF., Jarrott R., Lua LH., Collins BM., Martin JL. DIP original experiment: DIP-253352X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Possible roles for Munc18-1 domain 3a and Syntaxin1 N-peptide and C-terminal anchor in SNARE complex formation. Possible roles for Munc18-1 domain 3a and Syntaxin1 N-peptide and C-terminal anchor in SNARE complex formation. Possible roles for Munc18-1 domain 3a and Syntaxin1 N-peptide and C-terminal anchor in SNARE complex formation. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Hu SH., Christie MP., Saez NJ., Latham CF., Jarrott R., Lua LH., Collins BM., Martin JL. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Hu SH., Christie MP., Saez NJ., Latham CF., Jarrott R., Lua LH., Collins BM., Martin JL. DIP original experiment: DIP-253350X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Possible roles for Munc18-1 domain 3a and Syntaxin1 N-peptide and C-terminal anchor in SNARE complex formation. Possible roles for Munc18-1 domain 3a and Syntaxin1 N-peptide and C-terminal anchor in SNARE complex formation. Possible roles for Munc18-1 domain 3a and Syntaxin1 N-peptide and C-terminal anchor in SNARE complex formation. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Hu SH., Christie MP., Saez NJ., Latham CF., Jarrott R., Lua LH., Collins BM., Martin JL. Only protein-protein interactions in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Hu SH., Christie MP., Saez NJ., Latham CF., Jarrott R., Lua LH., Collins BM., Martin JL. DIP original experiment: DIP-253355X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Possible roles for Munc18-1 domain 3a and Syntaxin1 N-peptide and C-terminal anchor in SNARE complex formation. Possible roles for Munc18-1 domain 3a and Syntaxin1 N-peptide and C-terminal anchor in SNARE complex formation. Possible roles for Munc18-1 domain 3a and Syntaxin1 N-peptide and C-terminal anchor in SNARE complex formation. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Hu SH., Christie MP., Saez NJ., Latham CF., Jarrott R., Lua LH., Collins BM., Martin JL. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Hu SH., Christie MP., Saez NJ., Latham CF., Jarrott R., Lua LH., Collins BM., Martin JL. DIP original experiment: DIP-253358X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Possible roles for Munc18-1 domain 3a and Syntaxin1 N-peptide and C-terminal anchor in SNARE complex formation. Possible roles for Munc18-1 domain 3a and Syntaxin1 N-peptide and C-terminal anchor in SNARE complex formation. Possible roles for Munc18-1 domain 3a and Syntaxin1 N-peptide and C-terminal anchor in SNARE complex formation. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Hu SH., Christie MP., Saez NJ., Latham CF., Jarrott R., Lua LH., Collins BM., Martin JL. Only protein-protein interactions in vitro In vitro ion exchange chrom ion exchange chromatography IEC IEC ion exchange chrom predetermined predetermined participant predetermined Hu SH., Christie MP., Saez NJ., Latham CF., Jarrott R., Lua LH., Collins BM., Martin JL. DIP original experiment: DIP-253359X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Possible roles for Munc18-1 domain 3a and Syntaxin1 N-peptide and C-terminal anchor in SNARE complex formation. Possible roles for Munc18-1 domain 3a and Syntaxin1 N-peptide and C-terminal anchor in SNARE complex formation. Possible roles for Munc18-1 domain 3a and Syntaxin1 N-peptide and C-terminal anchor in SNARE complex formation. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Hu SH., Christie MP., Saez NJ., Latham CF., Jarrott R., Lua LH., Collins BM., Martin JL. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Hu SH., Christie MP., Saez NJ., Latham CF., Jarrott R., Lua LH., Collins BM., Martin JL. DIP original experiment: DIP-253351X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Possible roles for Munc18-1 domain 3a and Syntaxin1 N-peptide and C-terminal anchor in SNARE complex formation. Possible roles for Munc18-1 domain 3a and Syntaxin1 N-peptide and C-terminal anchor in SNARE complex formation. Possible roles for Munc18-1 domain 3a and Syntaxin1 N-peptide and C-terminal anchor in SNARE complex formation. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Hu SH., Christie MP., Saez NJ., Latham CF., Jarrott R., Lua LH., Collins BM., Martin JL. Only protein-protein interactions in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Hu SH., Christie MP., Saez NJ., Latham CF., Jarrott R., Lua LH., Collins BM., Martin JL. DIP original experiment: DIP-253356X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Possible roles for Munc18-1 domain 3a and Syntaxin1 N-peptide and C-terminal anchor in SNARE complex formation. vamp2_rat Vesicle-associated membrane protein 2 Vamp2 Syb2 Synaptobrevin-2 protein protein rat Rattus norvegicus (Rat) Rat MSATAATVPPAAPAGEGGPPAPPPNLTSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNLKMMIILGVICAIILIIIIVYFST DIP protein P63045 original sequence version: 95 DIP protein P63045 original sequence version: 90 DIP protein P63045 original sequence version: 64 DIP protein P63045 original sequence version: 62 DIP protein P63045 original sequence version: 85 DIP protein P63045 original sequence version: 104 DIP protein P63045 original sequence version: 77 DIP protein P63045 original sequence version: 75 DIP protein P63045 original sequence version: 106 4A0D0D56B5409D0A stxb1_rat Syntaxin-binding protein 1 Stxbp1 Unc18a Protein unc-18 homolog 1 Protein unc-18 homolog A N-Sec1 rbSec1 p67 protein protein rat Rattus norvegicus (Rat) Rat MAPIGLKAVVGEKIMHDVIKKVKKKGEWKVLVVDQLSMRMLSSCCKMTDIMTEGITIVEDINKRREPLPSLEAVYLITPSEKSVHSLISDFKDPPTAKYRAAHVFFTDSCPDALFNELVKSRAAKVIKTLTEINIAFLPYESQVYSLDSADSFQSFYSPHKAQMKNPILERLAEQIATLCATLKEYPAVRYRGEYKDNALLAQLIQDKLDAYKADDPTMGEGPDKARSQLLILDRGFDPSSPVLHELTFQAMSYDLLPIENDVYKYETSGIGEARVKEVLLDEDDDLWIALRHKHIAEVSQEVTRSLKDFSSSKRMNTGEKTTMRDLSQMLKKMPQYQKELSKYSTHLHLAEDCMKHYQGTVDKLCRVEQDLAMGTDAEGEKIKDPMRAIVPILLDANVSTYDKIRIILLYIFLKNGITEENLNKLIQHAQIPPEDSEIITNMAHLGVPIVTDSTLRRRSKPERKERISEQTYQLSRWTPIIKDIMEDTIEDKLDTKHYPYISTRSSASFSTTAVSARYGHWHKNKAPGEYRSGPRLIIFILGGVSLNEMRCAYEVTQANGKWEVLIGSTHILTPQKLLDTLKKLNKTDEEISS DIP protein P61765 original sequence version: 98 DIP protein P61765-1 original sequence version: 86 DIP protein P61765-1 original sequence version: 79 DIP protein P61765 original sequence version: 116 2DD0715F875CE0F3 stx4_mouse Syntaxin-4 Stx4 Stx4a protein protein mouse Mus musculus Mouse MRDRTHELRQGDNISDDEDEVRVALVVHSGAARLGSPDDEFFQKVQTIRQTMAKLESKVRELEKQQVTILATPLPEESMKQGLQNLREEIKQLGREVRAQLKAIEPQKEEADENYNSVNTRMKKTQHGVLSQQFVELINKCNSMQSEYREKNVERIRRQLKITNAGMVSDEELEQMLDSGQSEVFVSNILKDTQVTRQALNEISARHSEIQQLERSIRELHEIFTFLATEVEMQGEMINRIEKNILSSADYVERGQEHVKIALENQKKARKKKVMIAICVSVTVLILAVIIGITITVG DIP protein P70452 original sequence version: 120 DIP protein P70452 original sequence version: 108 FCD1477E1126CEC1 stx1a_rat Syntaxin-1A Synaptotagmin-associated 35 kDa protein Neuron-specific antigen HPC-1 Stx1a Sap protein protein rat Rattus norvegicus (Rat) Rat MKDRTQELRTAKDSDDDDDVTVTVDRDRFMDEFFEQVEEIRGFIDKIAENVEEVKRKHSAILASPNPDEKTKEELEELMSDIKKTANKVRSKLKSIEQSIEQEEGLNRSSADLRIRKTQHSTLSRKFVEVMSEYNATQSDYRERCKGRIQRQLEITGRTTTSEELEDMLESGNPAIFASGIIMDSSISKQALSEIETRHSEIIKLENSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHAVDYVERAVSDTKKAVKYQSKARRKKIMIIICCVILGIIIASTIGGIFG DIP protein P32851 original sequence version: 74 DIP protein P32851 original sequence version: 78 DIP protein P32851 original sequence version: 142 DIP protein P32851 original sequence version: 138 DIP protein P32851 original sequence version: 89 DIP protein P32851 original sequence version: 115 DIP protein P32851 original sequence version: 134 DIP protein P32851 original sequence version: 121 DIP protein P32851 original sequence version: 123 DIP protein P32851 original sequence version: 150 DIP protein P32851 original sequence version: 156 DIP protein P32851 original sequence version: 163 DIP protein P32851 original sequence version: 126 DIP protein P32851 original sequence version: 124 DIP protein P32851 original sequence version: 158 8F929F489E323CAA snp25_rat Synaptosomal-associated protein 25 Snap25 Snap Synaptosomal-associated 25 kDa protein Super protein protein protein rat Rattus norvegicus (Rat) Rat MAEDADMRNELEEMQRRADQLADESLESTRRMLQLVEESKDAGIRTLVMLDEQGEQLERIEEGMDQINKDMKEAEKNLTDLGKFCGLCVCPCNKLKSSDAYKKAWGNNQDGVVASQPARVVDEREQMAISGGFIRRVTNDARENEMDENLEQVSGIIGNLRHMALDMGNEIDTQNRQIDRIMEKADSNKTRIDEANQRATKMLGSG DIP protein P60881 original sequence version: 105 DIP protein P60881 original sequence version: 40 DIP protein P60881 original sequence version: 106 DIP protein P60881 original sequence version: 78 DIP protein P60881 original sequence version: 75 DIP protein P60881 original sequence version: 100 DIP protein P60881 original sequence version: 120 DIP protein P60881 original sequence version: 131 DIP protein P60881 original sequence version: 93 FBED2B082A4CB6A6 q60770-1 Syntaxin-binding protein 3 Stxbp3 Stxbp3a Unc18c MUNC-18-3 Mammalian homolog of Unc-18c Protein unc-18 homolog 3 Protein unc-18 homolog C protein protein mouse Mus musculus Mouse MAPPVSERGLKSVVWRKIKTAVFDDCRKEGEWKIMLLDEFTTKLLSSCCKMTDLLEEGITVIENIYKNREPVRQMKALYFISPTPKSVDCFLRDFGSKSEKKYKAAYIYFTDFCPDSLFNKIKASCSKSIRRCKEINISFIPQESQVYTLDVPDAFYYCYSPDPSNASRKEVVMEAMAEQIVTVCATLDENPGVRYKSKPLDNASKLAQLVEKKLEDYYKIDEKGLIKGKTQSQLLIIDRGFDPVSTVLHELTFQAMAYDLLPIENDTYKYKTDGKEKEAVLEEDDDLWVRVRHRHIAVVLEEIPKLMKEISSTKKATEGKTSLSALTQLMKKMPHFRKQISKQVVHLNLAEDCMNKFKLNIEKLCKTEQDLALGTDAEGQRVKDSMLVLLPVLLNKNHDNCDKIRAVLLYIFGINGTTEENLDRLIHNVKIEDDSDMIRNWSHLGVPIVPPSQQAKPLRKDRSAEETFQLSRWTPFIKDIMEDAIDNRLDSKEWPYCSRCPAVWNGSGAVSARQKPRTNYLELDRKNGSRLIIFVIGGITYSEMRCAYEVSQAHKSCEVIIGSTHILTPRKLLDDIKMLNKSKDKVSFKDE DIP protein Q60770-1 original sequence version: 99 DIP protein Q60770-1 original sequence version: 88 stx4-stxbp3-3 7 16 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 13 unspecified role unspecified role unspecified role unspecified role Region 1-10 Region 1-10 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain in vitro In vitro direct interaction direct interaction stx1a-stxbp1-18 5 12 unspecified role unspecified role prey prey ecolx Escherichia coli 14 unspecified role unspecified role bait bait Region 1-261 Region 1-261 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecolx Escherichia coli direct interaction direct interaction stx1a-stxbp1-19 1 12 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 14 unspecified role unspecified role unspecified role unspecified role Region 1-10 Region 1-10 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain in vitro In vitro direct interaction direct interaction stx4-stxbp3-4 10 16 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 13 unspecified role unspecified role unspecified role unspecified role Region 1-10 Region 1-10 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain in vitro In vitro direct interaction direct interaction stx1a-snap25-1 4 15 unspecified role unspecified role prey prey ecolx Escherichia coli 11 unspecified role unspecified role prey prey Region 1-94 Region 1-94 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 14 unspecified role unspecified role bait bait Region 1-261 Region 1-261 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecolx Escherichia coli association association stx1a-snap25-2 9 15 unspecified role unspecified role prey prey ecolx Escherichia coli 11 unspecified role unspecified role prey prey Region 1-94 Region 1-94 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 12 unspecified role unspecified role prey prey ecolx Escherichia coli 14 unspecified role unspecified role bait bait Region 1-261 Region 1-261 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecolx Escherichia coli association association stx1a-stxbp3-1 2 16 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 14 unspecified role unspecified role unspecified role unspecified role Region 1-10 Region 1-10 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain in vitro In vitro direct interaction direct interaction stx4-stxbp1-1 6 13 unspecified role unspecified role unspecified role unspecified role Region 1-10 Region 1-10 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain in vitro In vitro 12 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction stx4-stxbp1-2 3 13 unspecified role unspecified role unspecified role unspecified role Region 1-10 Region 1-10 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain in vitro In vitro 12 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction snap25-stx1a-19 8 15 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 11 unspecified role unspecified role unspecified role unspecified role Region 1-94 Region 1-94 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 14 unspecified role unspecified role unspecified role unspecified role Region 180-261 Region 180-261 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli association association