DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Phosphorylation of Grainy head by ERK is essential for wound-dependent regeneration but not for development of an epidermal barrier. Phosphorylation of Grainy head by ERK is essential for wound-dependent regeneration but not for development of an epidermal barrier. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Kim M., McGinnis W. Only protein-protein interactions in vitro In vitro protein kinase assay protein kinase assay weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Kim M., McGinnis W. DIP original experiment: DIP-249085X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Phosphorylation of Grainy head by ERK is essential for wound-dependent regeneration but not for development of an epidermal barrier. p13002-1 Protein grainyhead DNA-binding protein ELF-1 Element I-binding activity Protein grainy-head Transcription factor NTF-1 grh elf1 CG5058 A protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MSTSTATTSVITSNELSLSGHAHGHGHAHQLHQHTHSRLGVGVGVGILSDASLSPIQQGSGGHSGGGNTNSSPLAPNGVPLLTTMHRSPDSPQPELATMTNVNVLDLHTDNSKLYDKEAVFIYETPKVVMPADGGGGNNSDEGHAIDARIAAQMGNQAQQQQQQQQQTEHQPLAKIEFDENQIIRVVGPNGEQQQIISREIINGEHHILSRNEAGEHILTRIVSDPSKLMPNDNAVATAMYNQAQKMNNDHGQAVYQTSPLPLDASVLHYSGGNDSNVIKTEADIYEDHKKHAAAAAAAAGGGSIIYTTSDPNGVNVKQLPHLTVPQKLDPDLYQADKHIDLIYNDGSKTVIYSTTDQKSLEIYSGGDIGSLVSDGQVVVQAGLPYATTTGAGGQPVYIVADGALPAGVEEHLQSGKLNGQTTPIDVSGLSQNEIQGFLLGSHPSSSATVSTTGVVSTTTISHHQQQQQQQQQQQQQQQQQHQQQQQHPGDIVSAAGVGSTGSIVSSAAQQQQQQQLISIKREPEDLRKDPKNGNIAGAATANGPGSVITQKSFDYTELCQPGTLIDANGSIPVSVNSIQQRTAVHGSQNSPTTSLVDTSTNGSTRSRPWHDFGRQNDADKIQIPKIFTNVGFRYHLESPISSSQRREDDRITYINKGQFYGITLEYVHDAEKPIKNTTVKSVIMLMFREEKSPEDEIKAWQFWHSRQHSVKQRILDADTKNSVGLVGCIEEVSHNAIAVYWNPLESSAKINIAVQCLSTDFSSQKGVKGLPLHVQIDTFEDPRDTAVFHRGYCQIKVFCDKGAERKTRDEERRAAKRKMTATGRKKLDELYHPVTDRSEFYGMQDFAKPPVLFSPAEDMEKVGQLGIGAATGMTFNPLSNGNSNSNSHSSLQSFYGHETDSPDLKGASPFLLHGQKVATPTLKFHNHFPPDMQTDKKDHILDQNMLTSTPLTDFGPPMKRGRMTPPTSERVMLYVRQENEEVYTPLHVVPPTTIGLLNAIENKYKISTTSINNIYRTNKKGITAKIDDDMISFYCNEDIFLLEVQQIEDDLYDVTLTELPNQ DIP protein P13002-1 original sequence version: 114 mk01_mouse Mitogen-activated protein kinase 1 Mapk1 Erk2 Mapk Prkm1 Extracellular signal-regulated kinase 2 Mitogen-activated protein kinase 2 MAP kinase isoform p42 ERT1 protein protein mouse Mus musculus Mouse MAAAAAAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNLNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS DIP protein P63085 original sequence version: 120 DIP protein P63085 original sequence version: 94 DIP protein P63085 original sequence version: 88 DIP protein P63085 original sequence version: 103 DIP protein P63085 original sequence version: 121 DIP protein P63085 original sequence version: 101 3BBCF22471EDBA0B grh-mapk1-1 1 2 enzyme target enzyme target substrate substrate unspecified role unspecified role Region 1-136 Region 1-136 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Region 75-1063 Region 75-1063 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain P13002-1:p.Ser88Ala S88A mutation decreasing rate mutation decreasing interaction rate mutation decreasing rate alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain S A This feature has been corrected as a result of our quality control procedures. The original label was 'S88A'. Wed May 02 15:41:01 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser88ala' Tue Jun 30 18:18:48 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser88Ala' P13002-1:p.Ser91Ala S91A mutation decreasing rate mutation decreasing interaction rate mutation decreasing rate alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain S A This feature has been corrected as a result of our quality control procedures. The original label was 'S91A'. Wed May 02 15:04:43 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser91ala' Tue Jun 30 19:24:12 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser91Ala' P13002-1:p.[Ser88Ala;Ser91Ala] S88A/S91A mutation decreasing rate mutation decreasing interaction rate mutation decreasing rate alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain S A certain certain sequence position certain certain certain sequence position certain S A This feature has been corrected as a result of our quality control procedures. The original label was 'S88A/S91A'. Wed May 02 15:27:39 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser88ala,ser91ala' Tue Jun 30 18:17:54 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ser88Ala;Ser91Ala]' ecolx Escherichia coli 3 enzyme enzyme unspecified role unspecified role ecolx Escherichia coli phosphorylation phosphorylation reaction phosphorylation