DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Adaptin-like protein TPLATE and clathrin recruitment during plant somatic cytokinesis occurs via two distinct pathways. Adaptin-like protein TPLATE and clathrin recruitment during plant somatic cytokinesis occurs via two distinct pathways. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Van Damme D., Gadeyne A., Vanstraelen M., Inzé D., Van Montagu MC., De Jaeger G., Russinova E., Geelen D. Only protein-protein interactions nicbe Nicotiana benthamiana bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Van Damme D., Gadeyne A., Vanstraelen M., Inzé D., Van Montagu MC., De Jaeger G., Russinova E., Geelen D. DIP original experiment: DIP-249081X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Adaptin-like protein TPLATE and clathrin recruitment during plant somatic cytokinesis occurs via two distinct pathways. Adaptin-like protein TPLATE and clathrin recruitment during plant somatic cytokinesis occurs via two distinct pathways. Adaptin-like protein TPLATE and clathrin recruitment during plant somatic cytokinesis occurs via two distinct pathways. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Van Damme D., Gadeyne A., Vanstraelen M., Inzé D., Van Montagu MC., De Jaeger G., Russinova E., Geelen D. Only protein-protein interactions nicbe Nicotiana benthamiana bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Van Damme D., Gadeyne A., Vanstraelen M., Inzé D., Van Montagu MC., De Jaeger G., Russinova E., Geelen D. DIP original experiment: DIP-249079X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Adaptin-like protein TPLATE and clathrin recruitment during plant somatic cytokinesis occurs via two distinct pathways. Adaptin-like protein TPLATE and clathrin recruitment during plant somatic cytokinesis occurs via two distinct pathways. Adaptin-like protein TPLATE and clathrin recruitment during plant somatic cytokinesis occurs via two distinct pathways. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Van Damme D., Gadeyne A., Vanstraelen M., Inzé D., Van Montagu MC., De Jaeger G., Russinova E., Geelen D. Only protein-protein interactions nicbe Nicotiana benthamiana bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Van Damme D., Gadeyne A., Vanstraelen M., Inzé D., Van Montagu MC., De Jaeger G., Russinova E., Geelen D. DIP original experiment: DIP-249078X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Adaptin-like protein TPLATE and clathrin recruitment during plant somatic cytokinesis occurs via two distinct pathways. Adaptin-like protein TPLATE and clathrin recruitment during plant somatic cytokinesis occurs via two distinct pathways. Adaptin-like protein TPLATE and clathrin recruitment during plant somatic cytokinesis occurs via two distinct pathways. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Van Damme D., Gadeyne A., Vanstraelen M., Inzé D., Van Montagu MC., De Jaeger G., Russinova E., Geelen D. Only protein-protein interactions nicbe Nicotiana benthamiana bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Van Damme D., Gadeyne A., Vanstraelen M., Inzé D., Van Montagu MC., De Jaeger G., Russinova E., Geelen D. DIP original experiment: DIP-249072X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Adaptin-like protein TPLATE and clathrin recruitment during plant somatic cytokinesis occurs via two distinct pathways. Adaptin-like protein TPLATE and clathrin recruitment during plant somatic cytokinesis occurs via two distinct pathways. Adaptin-like protein TPLATE and clathrin recruitment during plant somatic cytokinesis occurs via two distinct pathways. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Van Damme D., Gadeyne A., Vanstraelen M., Inzé D., Van Montagu MC., De Jaeger G., Russinova E., Geelen D. Only protein-protein interactions nicbe Nicotiana benthamiana bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Van Damme D., Gadeyne A., Vanstraelen M., Inzé D., Van Montagu MC., De Jaeger G., Russinova E., Geelen D. DIP original experiment: DIP-249077X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Adaptin-like protein TPLATE and clathrin recruitment during plant somatic cytokinesis occurs via two distinct pathways. Adaptin-like protein TPLATE and clathrin recruitment during plant somatic cytokinesis occurs via two distinct pathways. Adaptin-like protein TPLATE and clathrin recruitment during plant somatic cytokinesis occurs via two distinct pathways. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Van Damme D., Gadeyne A., Vanstraelen M., Inzé D., Van Montagu MC., De Jaeger G., Russinova E., Geelen D. Only protein-protein interactions nicbe Nicotiana benthamiana bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Van Damme D., Gadeyne A., Vanstraelen M., Inzé D., Van Montagu MC., De Jaeger G., Russinova E., Geelen D. DIP original experiment: DIP-249073X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Adaptin-like protein TPLATE and clathrin recruitment during plant somatic cytokinesis occurs via two distinct pathways. Adaptin-like protein TPLATE and clathrin recruitment during plant somatic cytokinesis occurs via two distinct pathways. Adaptin-like protein TPLATE and clathrin recruitment during plant somatic cytokinesis occurs via two distinct pathways. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Van Damme D., Gadeyne A., Vanstraelen M., Inzé D., Van Montagu MC., De Jaeger G., Russinova E., Geelen D. Only protein-protein interactions nicbe Nicotiana benthamiana bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Van Damme D., Gadeyne A., Vanstraelen M., Inzé D., Van Montagu MC., De Jaeger G., Russinova E., Geelen D. DIP original experiment: DIP-249075X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Adaptin-like protein TPLATE and clathrin recruitment during plant somatic cytokinesis occurs via two distinct pathways. Adaptin-like protein TPLATE and clathrin recruitment during plant somatic cytokinesis occurs via two distinct pathways. Adaptin-like protein TPLATE and clathrin recruitment during plant somatic cytokinesis occurs via two distinct pathways. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Van Damme D., Gadeyne A., Vanstraelen M., Inzé D., Van Montagu MC., De Jaeger G., Russinova E., Geelen D. Only protein-protein interactions nicbe Nicotiana benthamiana bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Van Damme D., Gadeyne A., Vanstraelen M., Inzé D., Van Montagu MC., De Jaeger G., Russinova E., Geelen D. DIP original experiment: DIP-249076X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Adaptin-like protein TPLATE and clathrin recruitment during plant somatic cytokinesis occurs via two distinct pathways. Adaptin-like protein TPLATE and clathrin recruitment during plant somatic cytokinesis occurs via two distinct pathways. Adaptin-like protein TPLATE and clathrin recruitment during plant somatic cytokinesis occurs via two distinct pathways. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Van Damme D., Gadeyne A., Vanstraelen M., Inzé D., Van Montagu MC., De Jaeger G., Russinova E., Geelen D. Only protein-protein interactions nicbe Nicotiana benthamiana bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Van Damme D., Gadeyne A., Vanstraelen M., Inzé D., Van Montagu MC., De Jaeger G., Russinova E., Geelen D. DIP original experiment: DIP-249082X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Adaptin-like protein TPLATE and clathrin recruitment during plant somatic cytokinesis occurs via two distinct pathways. Adaptin-like protein TPLATE and clathrin recruitment during plant somatic cytokinesis occurs via two distinct pathways. Adaptin-like protein TPLATE and clathrin recruitment during plant somatic cytokinesis occurs via two distinct pathways. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Van Damme D., Gadeyne A., Vanstraelen M., Inzé D., Van Montagu MC., De Jaeger G., Russinova E., Geelen D. Only protein-protein interactions nicbe Nicotiana benthamiana bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Van Damme D., Gadeyne A., Vanstraelen M., Inzé D., Van Montagu MC., De Jaeger G., Russinova E., Geelen D. DIP original experiment: DIP-249083X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Adaptin-like protein TPLATE and clathrin recruitment during plant somatic cytokinesis occurs via two distinct pathways. Adaptin-like protein TPLATE and clathrin recruitment during plant somatic cytokinesis occurs via two distinct pathways. Adaptin-like protein TPLATE and clathrin recruitment during plant somatic cytokinesis occurs via two distinct pathways. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Van Damme D., Gadeyne A., Vanstraelen M., Inzé D., Van Montagu MC., De Jaeger G., Russinova E., Geelen D. Only protein-protein interactions nicbe Nicotiana benthamiana bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Van Damme D., Gadeyne A., Vanstraelen M., Inzé D., Van Montagu MC., De Jaeger G., Russinova E., Geelen D. DIP original experiment: DIP-249080X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Adaptin-like protein TPLATE and clathrin recruitment during plant somatic cytokinesis occurs via two distinct pathways. Adaptin-like protein TPLATE and clathrin recruitment during plant somatic cytokinesis occurs via two distinct pathways. Adaptin-like protein TPLATE and clathrin recruitment during plant somatic cytokinesis occurs via two distinct pathways. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Van Damme D., Gadeyne A., Vanstraelen M., Inzé D., Van Montagu MC., De Jaeger G., Russinova E., Geelen D. Only protein-protein interactions nicbe Nicotiana benthamiana bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Van Damme D., Gadeyne A., Vanstraelen M., Inzé D., Van Montagu MC., De Jaeger G., Russinova E., Geelen D. DIP original experiment: DIP-249084X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Adaptin-like protein TPLATE and clathrin recruitment during plant somatic cytokinesis occurs via two distinct pathways. Adaptin-like protein TPLATE and clathrin recruitment during plant somatic cytokinesis occurs via two distinct pathways. Adaptin-like protein TPLATE and clathrin recruitment during plant somatic cytokinesis occurs via two distinct pathways. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Van Damme D., Gadeyne A., Vanstraelen M., Inzé D., Van Montagu MC., De Jaeger G., Russinova E., Geelen D. Only protein-protein interactions nicbe Nicotiana benthamiana bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Van Damme D., Gadeyne A., Vanstraelen M., Inzé D., Van Montagu MC., De Jaeger G., Russinova E., Geelen D. DIP original experiment: DIP-249071X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Adaptin-like protein TPLATE and clathrin recruitment during plant somatic cytokinesis occurs via two distinct pathways. Adaptin-like protein TPLATE and clathrin recruitment during plant somatic cytokinesis occurs via two distinct pathways. Adaptin-like protein TPLATE and clathrin recruitment during plant somatic cytokinesis occurs via two distinct pathways. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Van Damme D., Gadeyne A., Vanstraelen M., Inzé D., Van Montagu MC., De Jaeger G., Russinova E., Geelen D. Only protein-protein interactions nicbe Nicotiana benthamiana bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Van Damme D., Gadeyne A., Vanstraelen M., Inzé D., Van Montagu MC., De Jaeger G., Russinova E., Geelen D. DIP original experiment: DIP-249074X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Adaptin-like protein TPLATE and clathrin recruitment during plant somatic cytokinesis occurs via two distinct pathways. clc2_arath Clathrin light chain 2 At2g40060 CLC2 T28M21.22 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSAFEDDSFVILNDDASESVPVSGSFDATDSFSAFDGSLQVEDSVDDVFAAPSSDYGAYSNGDGIFGSNGDHDGPILPPPSEMESDEGFALREWRRQNAIQLEEKEKREKELLKQIIEEADQYKEEFHKKIEVTCENNKAANREKEKLYLENQEKFYAESSKNYWKAIAELVPKEVPTIEKRRGKKEQQDPKKPTVSVIQGPKPGKPTDLTRMRQILVKLKHNPPSHLKLTSQPPSEEAAAPPKNVPETKPTEAVTAA DIP protein O04209 original sequence version: 71 A8E4C855D86316E7 tplat_arath Protein TPLATE TPLATE At3g01780 T22 F4P13.33 F28J7.11 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDILFAQIQADLRSNDALRQSSALLQALQQSAAGRDISVIAKSAVEEIVASPASAVCKKLAFDLIRSTRLTPDLWDTVCSGVKTDLHFPDPDVTAAAVSILAALPAFSLPKLISDCSSEIASCFDSPSDNLRFSITETLGCILARDDLVTLCENNVGLLDKVSNWWARIGQNMLDKSDAVSKVAFESVGRLFQEFDSKRMSRLAGDKLVDSENSLAIRSKWVSSMVDIVWRKRSALMARSLVLPVETFRATVFPLVFAVKAVASGSVEVIRQLSKASSAAAAANATVVDSNAEKLVGVSDLVTHLAPFLASSLDPALIFEVGINMLYLADVAGGKPEWASQSIIAILTLWDRQEFSSARESIVRAVVTNLHLLDLHMQVSLFRRLLLMVRNLRAESDRMHALACICRTALCVHLFARESARRGQKPLPGTDIISLFEDARIKDDLNSVTSKSLFREELVAMLVESCFQLSLPLPEQKNSGMESRVIGALAYGTGYGALNWTEPALEVVEVCRPCVKWDCDGRTYAVDCYLKLLVRLCHIYDTRGGVKRLKDGASQDQILNETRLQNLQRELVKDLQEVNTPRILGRLIWTIAEHIDLEGLDPLLADDPDDPLNIIIANIHKVLFNLDAAATTSNRLQDVQAVLLCAQRMGSRHARAGQLLTKELEEYRNHAAADTVSKHQTRLILQRIKYVSNLPERKWAGVSETRGDYPFSHHKLTVQFYEPSAAQDRKLEGLIHKAILELWRPKPTELTLFLTKGVDSTSIKVPPTAYPLTGSSDPCYIEAYHLADTNDGRVTLHLKIINLTELELNRVDIRVGLSGALYFMDGSPQAVRQLRNLVSQDPVQCSVTVGVSQFERCGFWVQVLYYPFRGARGEYDGDYIEEDPQIMKQKRGSKAELGEPVILRCQPYKIPLTELLLPHKISPVEFFRLWPSLPAVAEYTGTYMYEGSGFMATAAQQYGASPFLSGLKSLSSKPFHRVCSHIIRTVAGFQLCYAAKTWHGGFVGMMIFGASEVSRNMDLGDETTTMMCKFVVRASEASITKQIESDIQGWCDDLTDGGVEYMPEDEVKATAAEKLKISMERIALLKAAQPKKTSKIEEESENEEEEEGEEEDDDEEVKEKKEKEEGKDKEEKKKKEKEKGTFSKLTAEETEHMALQAAVLQEWHILCKDRKYTKVN DIP protein F4J8D3 original sequence version: 11 5D1AB2378BD3CE19 clah2_arath Clathrin heavy chain 2 At3g08530 CHC2 CHC1 F17O14.1 T8G24.1 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAAANAPITMKEVLTLPSIGINQQFITFTNVTMESDKYICVRETSPQNSVVIIDMNMPMQPLRRPITADSALMNPNSKILALKAQVPGTTQDHLQIFNIEAKAKLKSHQMPEQVVFWKWITPKMLGLVTQNSVYHWSIEGDSEPVKMFDRTANLANNQIINYKCSPNEKWLVLIGIAPGSPERQQLVKGNMQLFSVDQQRSQALEAHAASFAQFKVPGNENPSILISFASKSFNAGQITSKLHVIELGAQPGKPSFTKKQADLFFPPDFADDFPVAMQVSHKFNLIYVITKLGLLFVYDLETASAIYRNRISPDPIFLTSEASSVGGFYAINRRGQVLLATVNEATIIPFISGQLNNLELAVNLAKRGNLPGAENLVVQRFQELFAQTKYKEAAELAAESPQGILRTPDTVAKFQSVPVQAGQTPPLLQYFGTLLTRGKLNSYESLELSRLVVNQNKKNLLENWLAEDKLECSEELGDLVKTVDNDLALKIYIKARATPKVVAAFAERREFDKILIYSKQVGYTPDYLFLLQTILRTDPQGAVNFALMMSQMEGGSPVDYNTITDLFLQRNLIREATSFLLDVLKPNLPEHAFLQTKVLEINLVTFPNVADAVLANGMFTHYDRPRIAQLCEKAGLYIQSLKHYSELPDIKRVIVNTHAIEPQALVEFFGTLSSEWAMECMKDLLLVNLRGNLQIIVQACKEYCEQLGVDACIKLFEQFKSYEGLYFFLGSYLSMSEDPEIHFKYIEAAAKTGQIKEVERVTRESNFYDAEKTKNFLMEAKLPDARPLINVCDRFSFVPDLTHYLYTNNMLRYIEGYVQKVNPGNAPLVVGQLLDDECPEDFIKGLILSVRSLLPVEPLVEECEKRNRLRLLTQFLEHLVSEGSQDVHVHNALGKIIIDSNNNPEHFLTTNPYYDSKVVGKYCEKRDPTLAVVAYRRGQCDEELINVTNKNSLFKLQARYVVERMDGDLWDKVLDENNDYRRQLIDQVVSTALPESKSPEQVSAAVKAFMTADLPHELIELLEKIVLQNSAFSGNFNLQNLLILTAIKADPSRVMDYINRLDNFDGPAVGEVAVEAQLYEEAFAIFKKFNLNVQAVNVLLDNVRSIERAVEFAFRVEEDSVWSQVAKAQLREGLVSDAIESFIRADDATHFLEVIRVSEDTDVYDDLVKYLLMVRQKVKEPKVDSELIYAYAKIDRLGEIEEFILMPNVANLQHVGDRLYDEALYEAAKIIYAFISNWGKLAVTLVKLQQFQGAVDAARKANSAKTWKEVCFACVDAEEFRLAQICGLNIIIQVDDLEEVSEYYQNRGCFNELISLMESGLGLERAHMGIFTELGVLYARYRYEKLMEHIKLFSTRLNIPKLIRACDEQQHWQELTYLYIQYDEFDNAATTVMNHSPEAWEHMQFKDIVAKVANVELYYKAVHFYLQEHPDIINDLLNVLALRLDHTRVVDIMRKAGHLRLIKPYMIAVQSNNVSAVNEALNEIYVEEEDYDRLRESIDLHDSFDQIGLAQKIEKHELVEMRRVAAYIYKKAGRWKQSIALSKKDNMYKDCMETASQSGEHELAEQLLVYFIEQGKKECFATCLFVCYDLIRPDVALELAWINNMMDFAFPYLLQFIREYSGKVDELIKDKLEAQKEVKAKEQEEKDVISQQNMYAQMLPLALPAPPMPGMGGGGGYGPPPQMGGMPGMPPMPPYGMPPMGGY DIP protein Q0WLB5 original sequence version: 54 6A91D665A841F504 tplate-tplate-1 13 16 unspecified role unspecified role unspecified role unspecified role N-terminal domain of EGFP nEGFP-tag egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range nicbe Nicotiana benthamiana 16 unspecified role unspecified role unspecified role unspecified role C-terminal domain of EGFP cEGFP-tag egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range nicbe Nicotiana benthamiana direct interaction direct interaction clc2-tplate-1 7 15 unspecified role unspecified role unspecified role unspecified role C-terminal domain of EGFP cEGFP-tag egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range nicbe Nicotiana benthamiana 16 unspecified role unspecified role unspecified role unspecified role N-terminal domain of EGFP nEGFP-tag egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range nicbe Nicotiana benthamiana direct interaction direct interaction chc2-clc2-1 2 17 unspecified role unspecified role unspecified role unspecified role N-terminal domain of EGFP nEGFP-tag egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range nicbe Nicotiana benthamiana 15 unspecified role unspecified role unspecified role unspecified role C-terminal domain of EGFP cEGFP-tag egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range nicbe Nicotiana benthamiana direct interaction direct interaction chc2-tplate-1 10 16 unspecified role unspecified role unspecified role unspecified role N-terminal domain of EGFP nEGFP-tag egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range nicbe Nicotiana benthamiana 17 unspecified role unspecified role unspecified role unspecified role C-terminal domain of EGFP cEGFP-tag egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range nicbe Nicotiana benthamiana direct interaction direct interaction tplate-tplate-2 4 16 unspecified role unspecified role unspecified role unspecified role N-terminal domain of EGFP nEGFP-tag egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range nicbe Nicotiana benthamiana 16 unspecified role unspecified role unspecified role unspecified role C-terminal domain of EGFP cEGFP-tag egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range nicbe Nicotiana benthamiana direct interaction direct interaction clc2-tplate-2 8 15 unspecified role unspecified role unspecified role unspecified role C-terminal domain of EGFP cEGFP-tag egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range nicbe Nicotiana benthamiana 16 unspecified role unspecified role unspecified role unspecified role N-terminal domain of EGFP nEGFP-tag egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range nicbe Nicotiana benthamiana direct interaction direct interaction chc2-clc2-2 11 17 unspecified role unspecified role unspecified role unspecified role C-terminaldomain of EGFP cEGFP-tag egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range nicbe Nicotiana benthamiana 15 unspecified role unspecified role unspecified role unspecified role N-terminal domain of EGFP nEGFP-tag egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range nicbe Nicotiana benthamiana direct interaction direct interaction chc2-tplate-2 12 16 unspecified role unspecified role unspecified role unspecified role N-terminal domain of EGFP nEGFP-tag egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range nicbe Nicotiana benthamiana 17 unspecified role unspecified role unspecified role unspecified role C-terminal domain of EGFP cEGFP-tag egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range nicbe Nicotiana benthamiana direct interaction direct interaction clc2-tplate-3 6 15 unspecified role unspecified role unspecified role unspecified role N-terminal domain of EGFP nEGFP-tag egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range nicbe Nicotiana benthamiana 16 unspecified role unspecified role unspecified role unspecified role C-terminal domain of EGFP cEGFP-tag egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range nicbe Nicotiana benthamiana direct interaction direct interaction clc2-clc2-1 5 15 unspecified role unspecified role unspecified role unspecified role N-terminal domain of EGFP nEGFP-tag egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range nicbe Nicotiana benthamiana 15 unspecified role unspecified role unspecified role unspecified role C-terminal domain of EGFP cEGFP-tag egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range nicbe Nicotiana benthamiana direct interaction direct interaction chc2-clc2-3 1 17 unspecified role unspecified role unspecified role unspecified role C-terminal domain of EGFP cEGFP-tag egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range nicbe Nicotiana benthamiana 15 unspecified role unspecified role unspecified role unspecified role N-terminal domain of EGFP nEGFP-tag egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range nicbe Nicotiana benthamiana direct interaction direct interaction clc2-tplate-4 14 15 unspecified role unspecified role unspecified role unspecified role N-terminal domain of EGFP nEGFP-tag egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range nicbe Nicotiana benthamiana 16 unspecified role unspecified role unspecified role unspecified role C-terminal domain of EGFP cEGFP-tag egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range nicbe Nicotiana benthamiana direct interaction direct interaction clc2-clc2-2 3 15 unspecified role unspecified role unspecified role unspecified role N-terminal domain of EGFP nEGFP-tag egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range nicbe Nicotiana benthamiana 15 unspecified role unspecified role unspecified role unspecified role C-terminal domain of EGFP cEGFP-tag egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range nicbe Nicotiana benthamiana direct interaction direct interaction chc2-chc2-1 9 17 unspecified role unspecified role unspecified role unspecified role N-terminal domain of EGFP nEGFP-tag egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range nicbe Nicotiana benthamiana 17 unspecified role unspecified role unspecified role unspecified role C-terminal domain of EGFP cEGFP-tag egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range nicbe Nicotiana benthamiana direct interaction direct interaction