DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu The third conformation of p38α MAP kinase observed in phosphorylated p38α and in solution. The third conformation of p38α MAP kinase observed in phosphorylated p38α and in solution. Structure (London, England : 1993) 2010 imex curation Akella R., Min X., Wu Q., Gardner KH., Goldsmith EJ. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Akella R., Min X., Wu Q., Gardner KH., Goldsmith EJ. DIP original experiment: DIP-218304X Structure (London, England : 1993) 2010 IMEx The third conformation of p38α MAP kinase observed in phosphorylated p38α and in solution. The third conformation of p38α MAP kinase observed in phosphorylated p38α and in solution. The third conformation of p38α MAP kinase observed in phosphorylated p38α and in solution. Structure (London, England : 1993) 2010 imex curation Akella R., Min X., Wu Q., Gardner KH., Goldsmith EJ. Only protein-protein interactions in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Akella R., Min X., Wu Q., Gardner KH., Goldsmith EJ. DIP original experiment: DIP-218305X Structure (London, England : 1993) 2010 IMEx The third conformation of p38α MAP kinase observed in phosphorylated p38α and in solution. mk14_mouse Mitogen-activated protein kinase 14 Mapk14 Crk1 Csbp1 Csbp2 Mitogen-activated protein kinase p38 alpha CRK1 protein protein mouse Mus musculus Mouse MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGHRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLAQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES DIP protein P47811 original sequence version: 162 DIP protein P47811 original sequence version: 127 DIP protein P47811 original sequence version: 173 DFB03EBCE97BB51A pepmek3b MEK3b peptide peptide peptide polypeptide oligopeptide oligopeptide polypeptide chemical synthesis Chemical synthesis (Chemical synthesis) SKGKSKRKKDLRISCASK mapk14-pepmek3b-1 1 4 unspecified role unspecified role unspecified role unspecified role in vitro In vitro 3 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction mapk14-pepmek3b-2 2 4 unspecified role unspecified role unspecified role unspecified role in vitro In vitro 3 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction