DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Structure and control of the actin regulatory WAVE complex. Structure and control of the actin regulatory WAVE complex. Nature 2010 imex curation Chen Z., Borek D., Padrick SB., Gomez TS., Metlagel Z., Ismail AM., Umetani J., Billadeau DD., Otwinowski Z., Rosen MK. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Chen Z., Borek D., Padrick SB., Gomez TS., Metlagel Z., Ismail AM., Umetani J., Billadeau DD., Otwinowski Z., Rosen MK. DIP original experiment: DIP-254403X Nature 2010 IMEx Structure and control of the actin regulatory WAVE complex. Structure and control of the actin regulatory WAVE complex. Structure and control of the actin regulatory WAVE complex. Nature 2010 imex curation Chen Z., Borek D., Padrick SB., Gomez TS., Metlagel Z., Ismail AM., Umetani J., Billadeau DD., Otwinowski Z., Rosen MK. Only protein-protein interactions in vitro In vitro tem transmission electron microscopy tem predetermined predetermined participant predetermined Chen Z., Borek D., Padrick SB., Gomez TS., Metlagel Z., Ismail AM., Umetani J., Billadeau DD., Otwinowski Z., Rosen MK. DIP original experiment: DIP-254406X Nature 2010 IMEx Structure and control of the actin regulatory WAVE complex. Structure and control of the actin regulatory WAVE complex. Structure and control of the actin regulatory WAVE complex. Nature 2010 imex curation Chen Z., Borek D., Padrick SB., Gomez TS., Metlagel Z., Ismail AM., Umetani J., Billadeau DD., Otwinowski Z., Rosen MK. Only protein-protein interactions in vitro In vitro ion exchange chrom ion exchange chromatography IEC IEC ion exchange chrom predetermined predetermined participant predetermined Chen Z., Borek D., Padrick SB., Gomez TS., Metlagel Z., Ismail AM., Umetani J., Billadeau DD., Otwinowski Z., Rosen MK. DIP original experiment: DIP-254405X Nature 2010 IMEx Structure and control of the actin regulatory WAVE complex. Structure and control of the actin regulatory WAVE complex. Structure and control of the actin regulatory WAVE complex. Nature 2010 imex curation Chen Z., Borek D., Padrick SB., Gomez TS., Metlagel Z., Ismail AM., Umetani J., Billadeau DD., Otwinowski Z., Rosen MK. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Chen Z., Borek D., Padrick SB., Gomez TS., Metlagel Z., Ismail AM., Umetani J., Billadeau DD., Otwinowski Z., Rosen MK. DIP original experiment: DIP-254408X Nature 2010 IMEx Structure and control of the actin regulatory WAVE complex. Structure and control of the actin regulatory WAVE complex. Structure and control of the actin regulatory WAVE complex. Nature 2010 imex curation Chen Z., Borek D., Padrick SB., Gomez TS., Metlagel Z., Ismail AM., Umetani J., Billadeau DD., Otwinowski Z., Rosen MK. Only protein-protein interactions in vitro In vitro ion exchange chrom ion exchange chromatography IEC IEC ion exchange chrom predetermined predetermined participant predetermined Chen Z., Borek D., Padrick SB., Gomez TS., Metlagel Z., Ismail AM., Umetani J., Billadeau DD., Otwinowski Z., Rosen MK. DIP original experiment: DIP-254404X Nature 2010 IMEx Structure and control of the actin regulatory WAVE complex. Structure and control of the actin regulatory WAVE complex. Structure and control of the actin regulatory WAVE complex. Nature 2010 imex curation Chen Z., Borek D., Padrick SB., Gomez TS., Metlagel Z., Ismail AM., Umetani J., Billadeau DD., Otwinowski Z., Rosen MK. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Chen Z., Borek D., Padrick SB., Gomez TS., Metlagel Z., Ismail AM., Umetani J., Billadeau DD., Otwinowski Z., Rosen MK. DIP original experiment: DIP-254407X Nature 2010 IMEx Structure and control of the actin regulatory WAVE complex. Structure and control of the actin regulatory WAVE complex. Structure and control of the actin regulatory WAVE complex. Nature 2010 imex curation Chen Z., Borek D., Padrick SB., Gomez TS., Metlagel Z., Ismail AM., Umetani J., Billadeau DD., Otwinowski Z., Rosen MK. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Chen Z., Borek D., Padrick SB., Gomez TS., Metlagel Z., Ismail AM., Umetani J., Billadeau DD., Otwinowski Z., Rosen MK. DIP original experiment: DIP-254402X Nature 2010 IMEx Structure and control of the actin regulatory WAVE complex. Structure and control of the actin regulatory WAVE complex. Structure and control of the actin regulatory WAVE complex. Nature 2010 imex curation Chen Z., Borek D., Padrick SB., Gomez TS., Metlagel Z., Ismail AM., Umetani J., Billadeau DD., Otwinowski Z., Rosen MK. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Chen Z., Borek D., Padrick SB., Gomez TS., Metlagel Z., Ismail AM., Umetani J., Billadeau DD., Otwinowski Z., Rosen MK. DIP original experiment: DIP-254401X Nature 2010 IMEx Structure and control of the actin regulatory WAVE complex. wasf1_human Wiskott-Aldrich syndrome protein family member 1 WASF1 KIAA0269 SCAR1 WAVE1 Protein WAVE-1 Verprolin homology domain-containing protein 1 protein protein human Homo sapiens Human MPLVKRNIDPRHLCHTALPRGIKNELECVTNISLANIIRQLSSLSKYAEDIFGELFNEAHSFSFRVNSLQERVDRLSVSVTQLDPKEEELSLQDITMRKAFRSSTIQDQQLFDRKTLPIPLQETYDVCEQPPPLNILTPYRDDGKEGLKFYTNPSYFFDLWKEKMLQDTEDKRKEKRKQKQKNLDRPHEPEKVPRAPHDRRREWQKLAQGPELAEDDANLLHKHIEVANGPASHFETRPQTYVDHMDGSYSLSALPFSQMSELLTRAEERVLVRPHEPPPPPPMHGAGDAKPIPTCISSATGLIENRPQSPATGRTPVFVSPTPPPPPPPLPSALSTSSLRASMTSTPPPPVPPPPPPPATALQAPAVPPPPAPLQIAPGVLHPAPPPIAPPLVQPSPPVARAAPVCETVPVHPLPQGEVQGLPPPPPPPPLPPPGIRPSSPVTVTALAHPPSGLHPTPSTAPGPHVPLMPPSPPSQVIPASEPKRHPSTLPVISDARSVLLEAIRKGIQLRKVEEQREQEAKHERIENDVATILSRRIAVEYSDSEDDSEFDEVDWLE DIP protein Q92558 original sequence version: 78 DIP protein Q92558 original sequence version: 82 DIP protein Q92558 original sequence version: 124 DIP protein Q92558 original sequence version: 87 44B4527BDB77BC6E nckp1_human Nck-associated protein 1 NCKAP1 HEM2 KIAA0587 NAP1 p125Nap1 Membrane-associated protein HEM-2 protein protein human Homo sapiens Human MSRSVLQPSQQKLAEKLTILNDRGVGMLTRLYNIKKACGDPKAKPSYLIDKNLESAVKFIVRKFPAVETRNNNQQLAQLQKEKSEILKNLALYYFTFVDVMEFKDHVCELLNTIDVCQVFFDITVNFDLTKNYLDLIITYTTLMILLSRIEERKAIIGLYNYAHEMTHGASDREYPRLGQMIVDYENPLKKMMEEFVPHSKSLSDALISLQMVYPRRNLSADQWRNAQLLSLISAPSTMLNPAQSDTMPCEYLSLDAMEKWIIFGFILCHGILNTDATALNLWKLALQSSSCLSLFRDEVFHIHKAAEDLFVNIRGYNKRINDIRECKEAAVSHAGSMHRERRKFLRSALKELATVLSDQPGLLGPKALFVFMALSFARDEIIWLLRHADNMPKKSADDFIDKHIAELIFYMEELRAHVRKYGPVMQRYYVQYLSGFDAVVLNELVQNLSVCPEDESIIMSSFVNTMTSLSVKQVEDGEVFDFRGMRLDWFRLQAYTSVSKASLGLADHRELGKMMNTIIFHTKMVDSLVEMLVETSDLSIFCFYSRAFEKMFQQCLELPSQSRYSIAFPLLCTHFMSCTHELCPEERHHIGDRSLSLCNMFLDEMAKQARNLITDICTEQCTLSDQLLPKHCAKTISQAVNKKSKKQTGKKGEPEREKPGVESMRKNRLVVTNLDKLHTALSELCFSINYVPNMVVWEHTFTPREYLTSHLEIRFTKSIVGMTMYNQATQEIAKPSELLTSVRAYMTVLQSIENYVQIDITRVFNNVLLQQTQHLDSHGEPTITSLYTNWYLETLLRQVSNGHIAYFPAMKAFVNLPTENELTFNAEEYSDISEMRSLSELLGPYGMKFLSESLMWHISSQVAELKKLVVENVDVLTQMRTSFDKPDQMAALFKRLSSVDSVLKRMTIIGVILSFRSLAQEALRDVLSYHIPFLVSSIEDFKDHIPRETDMKVAMNVYELSSAAGLPCEIDPALVVALSSQKSENISPEEEYKIACLLMVFVAVSLPTLASNVMSQYSPAIEGHCNNIHCLAKAINQIAAALFTIHKGSIEDRLKEFLALASSSLLKIGQETDKTTTRNRESVYLLLDMIVQESPFLTMDLLESCFPYVLLRNAYHAVYKQSVTSSA DIP protein Q9Y2A7 original sequence version: 81 DIP protein Q9Y2A7-1 original sequence version: 85 DIP protein Q9Y2A7 original sequence version: 85 DIP protein Q9Y2A7 original sequence version: 129 12D32BAC7080CB5A brk1_human Protein BRICK1 C3orf10 BRK1 HSPC300 MDS027 protein protein human Homo sapiens Human MAGQEDPVQREIHQDWANREYIEIITSSIKKIADFLNSFDMSCRSRLATLNEKLTALERRIEYIEARVTKGETLT DIP protein Q8WUW1 original sequence version: 62 DIP protein Q8WUW1-1 original sequence version: 65 DIP protein Q8WUW1 original sequence version: 106 637B5461A2D96587 abi2_human Abl interactor 2 Abelson interactor 2 Abl-binding protein 3 Arg-binding protein 1 ABI2 ARGBPIA protein protein human Homo sapiens Human MAELQMLLEEEIPGGRRALFDSYTNLERVADYCENNYIQSADKQRALEETKAYTTQSLASVAYLINTLANNVLQMLDIQASQLRRMESSINHISQTVDIHKEKVARREIGILTTNKNTSRTHKIIAPANLERPVRYIRKPIDYTILDDIGHGVKWLLRFKVSTQNMKMGGLPRTTPPTQKPPSPPMSGKGTLGRHSPYRTLEPVRPPVVPNDYVPSPTRNMAPSQQSPVRTASVNQRNRTYSSSGSSGGSHPSSRSSSRENSGSGSVGVPIAVPTPSPPSVFPAPAGSAGTPPLPATSASAPAPLVPATVPSSTAPNAAAGGAPNLADGFTSPTPPVVSSTPPTGHPVQFYSMNRPASRHTPPTIGGSLPYRRPPSITSQTSLQNQMNGGPFYSQNPVSDTPPPPPPVEEPVFDESPPPPPPPEDYEEEEAAVVEYSDPYAEEDPPWAPRSYLEKVVAIYDYTKDKEDELSFQEGAIIYVIKKNDDGWYEGVMNGVTGLFPGNYVESIMHYSE DIP protein Q9NYB9 original sequence version: 84 DIP protein Q9NYB9 original sequence version: 88 DIP protein Q9NYB9 original sequence version: 131 822983A69E5EA512 cyfp1_human Cytoplasmic FMR1-interacting protein 1 Specifically Rac1-associated protein 1 p140sra-1 CYFIP1 KIAA0068 protein protein human Homo sapiens Human MAAQVTLEDALSNVDLLEELPLPDQQPCIEPPPSSLLYQPNFNTNFEDRNAFVTGIARYIEQATVHSSMNEMLEEGQEYAVMLYTWRSCSRAIPQVKCNEQPNRVEIYEKTVEVLEPEVTKLMNFMYFQRNAIERFCGEVRRLCHAERRKDFVSEAYLITLGKFINMFAVLDELKNMKCSVKNDHSAYKRAAQFLRKMADPQSIQESQNLSMFLANHNKITQSLQQQLEVISGYEELLADIVNLCVDYYENRMYLTPSEKHMLLKVMGFGLYLMDGSVSNIYKLDAKKRINLSKIDKYFKQLQVVPLFGDMQIELARYIKTSAHYEENKSRWTCTSSGSSPQYNICEQMIQIREDHMRFISELARYSNSEVVTGSGRQEAQKTDAEYRKLFDLALQGLQLLSQWSAHVMEVYSWKLVHPTDKYSNKDCPDSAEEYERATRYNYTSEEKFALVEVIAMIKGLQVLMGRMESVFNHAIRHTVYAALQDFSQVTLREPLRQAIKKKKNVIQSVLQAIRKTVCDWETGHEPFNDPALRGEKDPKSGFDIKVPRRAVGPSSTQLYMVRTMLESLIADKSGSKKTLRSSLEGPTILDIEKFHRESFFYTHLINFSETLQQCCDLSQLWFREFFLELTMGRRIQFPIEMSMPWILTDHILETKEASMMEYVLYSLDLYNDSAHYALTRFNKQFLYDEIEAEVNLCFDQFVYKLADQIFAYYKVMAGSLLLDKRLRSECKNQGATIHLPPSNRYETLLKQRHVQLLGRSIDLNRLITQRVSAAMYKSLELAIGRFESEDLTSIVELDGLLEINRMTHKLLSRYLTLDGFDAMFREANHNVSAPYGRITLHVFWELNYDFLPNYCYNGSTNRFVRTVLPFSQEFQRDKQPNAQPQYLHGSKALNLAYSSIYGSYRNFVGPPHFQVICRLLGYQGIAVVMEELLKVVKSLLQGTILQYVKTLMEVMPKICRLPRHEYGSPGILEFFHHQLKDIVEYAELKTVCFQNLREVGNAILFCLLIEQSLSLEEVCDLLHAAPFQNILPRVHVKEGERLDAKMKRLESKYAPLHLVPLIERLGTPQQIAIAREGDLLTKERLCCGLSMFEVILTRIRSFLDDPIWRGPLPSNGVMHVDECVEFHRLWSAMQFVYCIPVGTHEFTVEQCFGDGLHWAGCMIIVLLGQQRRFAVLDFCYHLLKVQKHDGKDEIIKNVPLKKMVERIRKFQILNDEIITILDKYLKSGDGEGTPVEHVRCFQPPIHQSLASS DIP protein Q7L576 original sequence version: 55 DIP protein Q7L576-1 original sequence version: 59 DIP protein Q7L576 original sequence version: 59 DIP protein Q7L576 original sequence version: 100 D8F45E13207BEF16 p63000-1 Ras-related C3 botulinum toxin substrate 1 RAC1 Cell migration-inducing gene 5 protein Ras-like protein TC25 TC25 p21-Rac1 MIG5 Rac1A protein protein human Homo sapiens Human MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKRKRKCLLL DIP protein P63000-1 original sequence version: 44 DIP protein P63000 original sequence version: 133 DIP protein P63000-1 original sequence version: 128 DIP protein P63000 original sequence version: 90 DIP protein P63000 original sequence version: 91 DIP protein P63000 original sequence version: 92 DIP protein P63000 original sequence version: 80 DIP protein P63000 original sequence version: 106 DIP protein P63000 original sequence version: 95 DIP protein P63000 original sequence version: 112 DIP protein P63000 original sequence version: 128 DIP protein P63000 original sequence version: 137 DIP protein P63000 original sequence version: 157 DIP protein P63000 original sequence version: 116 DIP protein P63000-1 original sequence version: 124 mint ACEDF83A45E5EA67 wasf2_human Wiskott-Aldrich syndrome protein family member 2 WASF2 WAVE2 Protein WAVE-2 Verprolin homology domain-containing protein 2 protein protein human Homo sapiens Human MPLVTRNIEPRHLCRQTLPSVRSELECVTNITLANVIRQLGSLSKYAEDIFGELFTQANTFASRVSSLAERVDRLQVKVTQLDPKEEEVSLQGINTRKAFRSSTIQDQKLFDRNSLPVPVLETYNTCDTPPPLNNLTPYRDDGKEALKFYTDPSYFFDLWKEKMLQDTKDIMKEKRKHRKEKKDNPNRGNVNPRKIKTRKEEWEKMKMGQEFVESKEKLGTSGYPPTLVYQNGSIGCVENVDASSYPPPPQSDSASSPSPSFSEDNLPPPPAEFSYPVDNQRGSGLAGPKRSSVVSPSHPPPAPPLGSPPGPKPGFAPPPAPPPPPPPMIGIPPPPPPVGFGSPGTPPPPSPPSFPPHPDFAAPPPPPPPPAADYPTLPPPPLSQPTGGAPPPPPPPPPPGPPPPPFTGADGQPAIPPPLSDTTKPKSSLPAVSDARSDLLSAIRQGFQLRRVEEQREQEKRDVVGNDVATILSRRIAVEYSDSEDDSSEFDEDDWSD DIP protein Q9Y6W5 original sequence version: 93 DIP protein Q9Y6W5 original sequence version: 121 DIP protein Q9Y6W5 original sequence version: 137 C737CE963016DE94 rac1-cyfip1-2 4 10 unspecified role unspecified role prey prey trini Trichoplusia ni (Cabbage looper) Cabbage looper 14 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 13 unspecified role unspecified role prey prey Q7L576:p.Cys179Arg C179R mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain C R This feature has been corrected as a result of our quality control procedures. The original label was 'C179R'. Wed May 02 17:52:20 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys179arg' Tue Jun 30 15:40:51 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys179Arg' Q7L576:p.Arg190Asp R190D mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain R D This feature has been corrected as a result of our quality control procedures. The original label was 'R190D'. Wed May 02 14:48:55 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg190asp' Tue Jun 30 18:07:49 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg190Asp' Q7L576:p.[Glu434Arg;Phe626Asp] E434R/F626D mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain F D certain certain sequence position certain certain certain sequence position certain E R This feature has been corrected as a result of our quality control procedures. The original label was 'E434R/F626D'. Wed May 02 17:27:50 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu434arg,phe626asp' Tue Jun 30 18:48:30 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Glu434Arg;Phe626Asp]' Q7L576:p.Met632Asp M632D mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain M D This feature has been corrected as a result of our quality control procedures. The original label was 'M632D'. Wed May 02 17:18:25 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'met632asp' Wed May 02 18:03:43 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'met632asp' Tue Jun 30 17:09:26 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Met632Asp' spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm association association abi2-brk1-11 3 12 unspecified role unspecified role unspecified role unspecified role Region 1-158 Region 1-158 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 11 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 9 unspecified role unspecified role unspecified role unspecified role Region 1-154 Region 1-154 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli physical association physical association abi2-brk1-12 8 10 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper 12 unspecified role unspecified role unspecified role unspecified role Region 1-158 Region 1-158 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 11 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 9 unspecified role unspecified role unspecified role unspecified role Region 1-186/485-559 Region 1-186/485-559 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 13 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm physical association physical association abi2-brk1-13 5 10 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper 12 unspecified role unspecified role unspecified role unspecified role Region 1-158 Region 1-158 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 11 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 9 unspecified role unspecified role unspecified role unspecified role Region 1-154 Region 1-154 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 13 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm physical association physical association abi2-brk1-14 1 10 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper 12 unspecified role unspecified role unspecified role unspecified role Region 1-158 Region 1-158 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 11 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 9 unspecified role unspecified role unspecified role unspecified role Region 1-154 Region 1-154 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 13 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm physical association physical association wasf2-cyfip1-1 6 10 unspecified role unspecified role prey prey human Homo sapiens Human 15 unspecified role unspecified role bait bait Q9Y6W5:p.[Leu40Asp;Phe51Asp] L40D/F51D mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain F D certain certain sequence position certain certain certain sequence position certain L D This feature has been corrected as a result of our quality control procedures. The original label was 'L40D/F51D'. Wed May 02 19:54:53 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu40asp,phe51asp' Tue Jun 30 18:01:57 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Leu40Asp;Phe51Asp]' Q9Y6W5:p.[Ile50Asp;Leu54Asp] I50D/L54D mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L D certain certain sequence position certain certain certain sequence position certain I D This feature has been corrected as a result of our quality control procedures. The original label was 'I50D/L54D'. Wed May 02 19:06:43 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile50asp,leu54asp' Tue Jun 30 19:28:51 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ile50Asp;Leu54Asp]' HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 13 unspecified role unspecified role prey prey human Homo sapiens Human association association abi2-brk1-15 2 10 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper 12 unspecified role unspecified role unspecified role unspecified role Region 1-158 Region 1-158 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 11 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 9 unspecified role unspecified role unspecified role unspecified role Region 1-186/485-559 Region 1-186/485-559 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 13 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm physical association physical association cyfip1-nckap1-3 7 10 unspecified role unspecified role prey prey trini Trichoplusia ni (Cabbage looper) Cabbage looper 13 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm physical association physical association