DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Structural basis of oligomerization in septin-like GTPase of immunity-associated protein 2 (GIMAP2). Structural basis of oligomerization in septin-like GTPase of immunity-associated protein 2 (GIMAP2). Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Schwefel D., Fröhlich C., Eichhorst J., Wiesner B., Behlke J., Aravind L., Daumke O. Only protein-protein interactions ecolx Escherichia coli solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Schwefel D., Fröhlich C., Eichhorst J., Wiesner B., Behlke J., Aravind L., Daumke O. DIP original experiment: DIP-220621X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Structural basis of oligomerization in septin-like GTPase of immunity-associated protein 2 (GIMAP2). Structural basis of oligomerization in septin-like GTPase of immunity-associated protein 2 (GIMAP2). Structural basis of oligomerization in septin-like GTPase of immunity-associated protein 2 (GIMAP2). Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Schwefel D., Fröhlich C., Eichhorst J., Wiesner B., Behlke J., Aravind L., Daumke O. Only protein-protein interactions ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Schwefel D., Fröhlich C., Eichhorst J., Wiesner B., Behlke J., Aravind L., Daumke O. DIP original experiment: DIP-220622X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Structural basis of oligomerization in septin-like GTPase of immunity-associated protein 2 (GIMAP2). Structural basis of oligomerization in septin-like GTPase of immunity-associated protein 2 (GIMAP2). Structural basis of oligomerization in septin-like GTPase of immunity-associated protein 2 (GIMAP2). Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Schwefel D., Fröhlich C., Eichhorst J., Wiesner B., Behlke J., Aravind L., Daumke O. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Schwefel D., Fröhlich C., Eichhorst J., Wiesner B., Behlke J., Aravind L., Daumke O. DIP original experiment: DIP-220623X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Structural basis of oligomerization in septin-like GTPase of immunity-associated protein 2 (GIMAP2). Structural basis of oligomerization in septin-like GTPase of immunity-associated protein 2 (GIMAP2). Structural basis of oligomerization in septin-like GTPase of immunity-associated protein 2 (GIMAP2). Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Schwefel D., Fröhlich C., Eichhorst J., Wiesner B., Behlke J., Aravind L., Daumke O. Only protein-protein interactions in vitro In vitro solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Schwefel D., Fröhlich C., Eichhorst J., Wiesner B., Behlke J., Aravind L., Daumke O. DIP original experiment: DIP-220624X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Structural basis of oligomerization in septin-like GTPase of immunity-associated protein 2 (GIMAP2). Structural basis of oligomerization in septin-like GTPase of immunity-associated protein 2 (GIMAP2). Structural basis of oligomerization in septin-like GTPase of immunity-associated protein 2 (GIMAP2). Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Schwefel D., Fröhlich C., Eichhorst J., Wiesner B., Behlke J., Aravind L., Daumke O. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Schwefel D., Fröhlich C., Eichhorst J., Wiesner B., Behlke J., Aravind L., Daumke O. DIP original experiment: DIP-220620X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Structural basis of oligomerization in septin-like GTPase of immunity-associated protein 2 (GIMAP2). q96f15-1 GTPase IMAP family member 5 GIMAP5 IAN4L1 IAN5 IMAP3 Immunity-associated nucleotide 4-like 1 protein Immunity-associated nucleotide 5 protein Immunity-associated protein 3 Immune-associated nucleotide-binding protein 5 protein protein human Homo sapiens Human MGGFQRGKYGTMAEGRSEDNLSATPPALRIILVGKTGCGKSATGNSILGQPVFESKLRAQSVTRTCQVKTGTWNGRKVLVVDTPSIFESQADTQELYKNIGDCYLLSAPGPHVLLLVIQLGRFTAQDTVAIRKVKEVFGTGAMRHVVILFTHKEDLGGQALDDYVANTDNCSLKDLVRECERRYCAFNNWGSVEEQRQQQAELLAVIERLGREREGSFHSNDLFLDAQLLQRTGAGACQEDYRQYQAKVEWQVEKHKQELRENESNWAYKALLRVKHLMLLHYEIFVFLLLCSILFFIIFLFIFHYI DIP protein Q96F15-1 original sequence version: 77 gima2_human GTPase IMAP family member 2 GIMAP2 IMAP2 Immunity-associated protein 2 protein protein human Homo sapiens Human MDQNEHSHWGPHAKGQCASRSELRIILVGKTGTGKSAAGNSILRKQAFESKLGSQTLTKTCSKSQGSWGNREIVIIDTPDMFSWKDHCEALYKEVQRCYLLSAPGPHVLLLVTQLGRYTSQDQQAAQRVKEIFGEDAMGHTIVLFTHKEDLNGGSLMDYMHDSDNKALSKLVAACGGRICAFNNRAEGSNQDDQVKELMDCIEDLLMEKNGDHYTNGLYSLIQRSKCGPVGSDERVKEFKQSLIKYMETQRSYTALAEANCLKGALIKTQLCVLFCIQLFLRLIILWLCILHSMCNLFCCLLFSMCNLFCSLLFIIPKKLMIFLRTVIRLERKTPRL DIP protein Q9UG22 original sequence version: 71 DIP protein Q9UG22 original sequence version: 83 gimap2-1 5 7 unspecified role unspecified role unspecified role unspecified role Region 1-234 Region 1-234 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction gimap5-1 3 6 unspecified role unspecified role unspecified role unspecified role Region 1-241 Region 1-241 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction gimap2-2 4 7 unspecified role unspecified role unspecified role unspecified role Q9UG22:p.Ser54Ala S54A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain S A This feature has been corrected as a result of our quality control procedures. The original label was 'S54A'. Wed May 02 18:43:41 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser54ala' Tue Jun 30 17:17:52 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser54Ala' Q9UG22:p.Arg117Asp R117D mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain R D This feature has been corrected as a result of our quality control procedures. The original label was 'R117D'. Wed May 02 19:06:22 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg117asp' Tue Jun 30 17:49:18 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg117Asp' Region 1-260 Region 1-260 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction gimap2-3 1 7 unspecified role unspecified role unspecified role unspecified role Region 1-234 Region 1-234 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction gimap2-4 2 7 unspecified role unspecified role unspecified role unspecified role Region 1-234 Region 1-234 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction