DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Structure-based development of a receptor activator of nuclear factor-kappaB ligand (RANKL) inhibitor peptide and molecular basis for osteopetrosis. Structure-based development of a receptor activator of nuclear factor-kappaB ligand (RANKL) inhibitor peptide and molecular basis for osteopetrosis. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Ta HM., Nguyen GT., Jin HM., Choi J., Park H., Kim N., Hwang HY., Kim KK. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Ta HM., Nguyen GT., Jin HM., Choi J., Park H., Kim N., Hwang HY., Kim KK. DIP original experiment: DIP-220615X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Structure-based development of a receptor activator of nuclear factor-kappaB ligand (RANKL) inhibitor peptide and molecular basis for osteopetrosis. Structure-based development of a receptor activator of nuclear factor-kappaB ligand (RANKL) inhibitor peptide and molecular basis for osteopetrosis. Structure-based development of a receptor activator of nuclear factor-kappaB ligand (RANKL) inhibitor peptide and molecular basis for osteopetrosis. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Ta HM., Nguyen GT., Jin HM., Choi J., Park H., Kim N., Hwang HY., Kim KK. Only protein-protein interactions in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Ta HM., Nguyen GT., Jin HM., Choi J., Park H., Kim N., Hwang HY., Kim KK. DIP original experiment: DIP-220618X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Structure-based development of a receptor activator of nuclear factor-kappaB ligand (RANKL) inhibitor peptide and molecular basis for osteopetrosis. Structure-based development of a receptor activator of nuclear factor-kappaB ligand (RANKL) inhibitor peptide and molecular basis for osteopetrosis. Structure-based development of a receptor activator of nuclear factor-kappaB ligand (RANKL) inhibitor peptide and molecular basis for osteopetrosis. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Ta HM., Nguyen GT., Jin HM., Choi J., Park H., Kim N., Hwang HY., Kim KK. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Ta HM., Nguyen GT., Jin HM., Choi J., Park H., Kim N., Hwang HY., Kim KK. DIP original experiment: DIP-220616X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Structure-based development of a receptor activator of nuclear factor-kappaB ligand (RANKL) inhibitor peptide and molecular basis for osteopetrosis. Structure-based development of a receptor activator of nuclear factor-kappaB ligand (RANKL) inhibitor peptide and molecular basis for osteopetrosis. Structure-based development of a receptor activator of nuclear factor-kappaB ligand (RANKL) inhibitor peptide and molecular basis for osteopetrosis. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Ta HM., Nguyen GT., Jin HM., Choi J., Park H., Kim N., Hwang HY., Kim KK. Only protein-protein interactions in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Ta HM., Nguyen GT., Jin HM., Choi J., Park H., Kim N., Hwang HY., Kim KK. DIP original experiment: DIP-220617X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Structure-based development of a receptor activator of nuclear factor-kappaB ligand (RANKL) inhibitor peptide and molecular basis for osteopetrosis. Structure-based development of a receptor activator of nuclear factor-kappaB ligand (RANKL) inhibitor peptide and molecular basis for osteopetrosis. Structure-based development of a receptor activator of nuclear factor-kappaB ligand (RANKL) inhibitor peptide and molecular basis for osteopetrosis. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Ta HM., Nguyen GT., Jin HM., Choi J., Park H., Kim N., Hwang HY., Kim KK. Only protein-protein interactions in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Ta HM., Nguyen GT., Jin HM., Choi J., Park H., Kim N., Hwang HY., Kim KK. DIP original experiment: DIP-220619X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Structure-based development of a receptor activator of nuclear factor-kappaB ligand (RANKL) inhibitor peptide and molecular basis for osteopetrosis. tnr11_mouse Tumor necrosis factor receptor superfamily member 11A Receptor activator of NF-KB Osteoclast differentiation factor receptor Tnfrsf11a Rank protein protein mouse Mus musculus Mouse MAPRARRRRQLPAPLLALCVLLVPLQVTLQVTPPCTQERHYEHLGRCCSRCEPGKYLSSKCTPTSDSVCLPCGPDEYLDTWNEEDKCLLHKVCDAGKALVAVDPGNHTAPRRCACTAGYHWNSDCECCRRNTECAPGFGAQHPLQLNKDTVCTPCLLGFFSDVFSSTDKCKPWTNCTLLGKLEAHQGTTESDVVCSSSMTLRRPPKEAQAYLPSLIVLLLFISVVVVAAIIFGVYYRKGGKALTANLWNWVNDACSSLSGNKESSGDRCAGSHSATSSQQEVCEGILLMTREEKMVPEDGAGVCGPVCAAGGPWAEVRDSRTFTLVSEVETQGDLSRKIPTEDEYTDRPSQPSTGSLLLIQQGSKSIPPFQEPLEVGENDSLSQCFTGTESTVDSEGCDFTEPPSRTDSMPVSPEKHLTKEIEGDSCLPWVVSSNSTDGYTGSGNTPGEDHEPFPGSLKCGPLPQCAYSMGFPSEAAASMAEAGVRPQDRADERGASGSGSSPSDQPPASGNVTGNSNSTFISSGQVMNFKGDIIVVYVSQTSQEGPGSAEPESEPVGRPVQEETLAHRDSFAGTAPRFPDVCATGAGLQEQGAPRQKDGTSRPVQEQGGAQTSLHTQGSGQCAE DIP protein O35305 original sequence version: 82 DIP protein O35305 original sequence version: 91 DIP protein O35305 original sequence version: 102 F8C1872E99511D8E op34 RANKL inhibitor peptide peptide peptide polypeptide oligopeptide oligopeptide polypeptide chemical synthesis Chemical synthesis (Chemical synthesis) YCEIEFCYLIR l33 RANKL inhibitor peptide peptide peptide polypeptide oligopeptide oligopeptide polypeptide chemical synthesis Chemical synthesis (Chemical synthesis) YCWNSDCECCYRR o35235-1 Tumor necrosis factor ligand superfamily member 11 Tnfsf11 Opgl Rankl Trance Osteoclast differentiation factor Osteoprotegerin ligand Receptor activator of nuclear factor kappa-B ligand TNF-related activation-induced cytokine protein protein mouse Mus musculus Mouse MRRASRDYGKYLRSSEEMGSGPGVPHEGPLHPAPSAPAPAPPPAASRSMFLALLGLGLGQVVCSIALFLYFRAQMDPNRISEDSTHCFYRILRLHENADLQDSTLESEDTLPDSCRRMKQAFQGAVQKELQHIVGPQRFSGAPAMMEGSWLDVAQRGKPEAQPFAHLTINAASIPSGSHKVTLSSWYHDRGWAKISNMTLSNGKLRVNQDGFYYLYANICFRHHETSGSVPTDYLQLMVYVVKTSIKIPSSHNLMKGGSTKNWSGNSEFHFYSINVGGFFKLRAGEEISIQVSNPSLLDPDQDATYFGAFKVQDID DIP protein O35235-1 original sequence version: 115 DIP protein O35235-1 original sequence version: 127 tnfrsf11a-tnfsf11-11 4 6 unspecified role unspecified role unspecified role unspecified role Ectodomain Region 32-201 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain O35305:p.Glu126Ala E126A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain E A This feature has been corrected as a result of our quality control procedures. The original label was 'E126A'. Wed May 02 18:15:09 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu126ala' Tue Jun 30 20:03:14 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu126Ala' O35305:p.Lys97Ala K97A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain K A This feature has been corrected as a result of our quality control procedures. The original label was 'K97A'. Wed May 02 15:50:52 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys97ala' Tue Jun 30 16:59:31 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys97Ala' O35305:p.Asp85Ala D85A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain D A This feature has been corrected as a result of our quality control procedures. The original label was 'D85A'. Wed May 02 19:01:48 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp85ala' Tue Jun 30 19:27:26 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp85Ala' O35305:p.Cys127Ala C127A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain C A This feature has been corrected as a result of our quality control procedures. The original label was 'C127A'. Wed May 02 15:28:56 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys127ala' Tue Jun 30 17:59:15 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys127Ala' O35305:p.Gly54Arg G54R mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain G R This feature has been corrected as a result of our quality control procedures. The original label was 'G54R'. Wed May 02 18:55:42 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly54arg' Tue Jun 30 16:39:23 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly54Arg' O35305:p.Lys171Gly K171G mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain K G This feature has been corrected as a result of our quality control procedures. The original label was 'K171G'. Wed May 02 19:19:58 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys171gly' Tue Jun 30 17:55:11 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys171Gly' ecolx Escherichia coli 9 unspecified role unspecified role unspecified role unspecified role Ectodomain Region 157-316 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction tnfrsf11a-tnfsf11-12 1 6 unspecified role unspecified role unspecified role unspecified role Ectodomain Region 32-201 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 9 unspecified role unspecified role unspecified role unspecified role Ectodomain Region 157-316 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction op34-tnfsf11-1 5 7 unspecified role unspecified role unspecified role unspecified role in vitro In vitro 9 unspecified role unspecified role unspecified role unspecified role Ectodomain Region 157-316 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction tnfrsf11a-tnfsf11-13 3 6 unspecified role unspecified role unspecified role unspecified role Ectodomain Region 32-201 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 9 unspecified role unspecified role unspecified role unspecified role Ectodomain Region 157-316 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction l33-tnfsf11-1 2 8 unspecified role unspecified role unspecified role unspecified role in vitro In vitro 9 unspecified role unspecified role unspecified role unspecified role Ectodomain Region 157-316 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction