DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu IL-27 structural analysis demonstrates similarities with ciliary neurotrophic factor (CNTF) and leads to the identification of antagonistic variants. IL-27 structural analysis demonstrates similarities with ciliary neurotrophic factor (CNTF) and leads to the identification of antagonistic variants. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Rousseau F., Basset L., Froger J., Dinguirard N., Chevalier S., Gascan H. Only protein-protein interactions chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Rousseau F., Basset L., Froger J., Dinguirard N., Chevalier S., Gascan H. DIP original experiment: DIP-220561X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx IL-27 structural analysis demonstrates similarities with ciliary neurotrophic factor (CNTF) and leads to the identification of antagonistic variants. IL-27 structural analysis demonstrates similarities with ciliary neurotrophic factor (CNTF) and leads to the identification of antagonistic variants. IL-27 structural analysis demonstrates similarities with ciliary neurotrophic factor (CNTF) and leads to the identification of antagonistic variants. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Rousseau F., Basset L., Froger J., Dinguirard N., Chevalier S., Gascan H. Only protein-protein interactions chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Rousseau F., Basset L., Froger J., Dinguirard N., Chevalier S., Gascan H. DIP original experiment: DIP-220560X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx IL-27 structural analysis demonstrates similarities with ciliary neurotrophic factor (CNTF) and leads to the identification of antagonistic variants. il27b_human Interleukin-27 subunit beta Epstein-Barr virus-induced gene 3 protein EBI3 IL27B protein protein human Homo sapiens Human MTPQLLLALVLWASCPPCSGRKGPPAALTLPRVQCRASRYPIAVDCSWTLPPAPNSTSPVSFIATYRLGMAARGHSWPCLQQTPTSTSCTITDVQLFSMAPYVLNVTAVHPWGSSSSFVPFITEHIIKPDPPEGVRLSPLAERQLQVQWEPPGSWPFPEIFSLKYWIRYKRQGAARFHRVGPIEATSFILRAVRPRARYYVQVAAQDLTDYGELSDWSLPATATMSLGK DIP protein Q14213 original sequence version: 108 DIP protein Q14213 original sequence version: 93 CFBAD72D91859EF0 il27a_human Interleukin-27 subunit alpha Interleukin-30 p28 IL27 IL27A IL30 protein protein human Homo sapiens Human MGQTAGDLGWRLSLLLLPLLLVQAGVWGFPRPPGRPQLSLQELRREFTVSLHLARKLLSEVRGQAHRFAESHLPGVNLYLLPLGEQLPDVSLTFQAWRRLSDPERLCFISTTLQPFHALLGGLGTQGRWTNMERMQLWAMRLDLRDLQRHLRFQVLAAGFNLPEEEEEEEEEEEEERKGLLPGALGSALQGPAQVSWPQLLSTYRLLHSLELVLSRAVRELLLLSKAGHSVWPLGFPTLSPQP DIP protein Q8NEV9 original sequence version: 52 ebi3-il27-1 2 3 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey 4 unspecified role unspecified role prey prey Q8NEV9:p.Trp97Ala W97A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain W A This feature has been corrected as a result of our quality control procedures. The original label was 'W97A'. Wed May 02 20:08:07 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp97ala' Tue Jun 30 20:14:49 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp97Ala' V5-tag V5-tag v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range Q8NEV9:p.Trp197Ala W197A mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain W A This feature has been corrected as a result of our quality control procedures. The original label was 'W197A'. Wed May 02 16:29:05 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp197ala' Tue Jun 30 18:51:40 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp197Ala' chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey physical association physical association ebi3-il27-2 1 3 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range Q14213:p.Glu159Ala E159A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain E A This feature has been corrected as a result of our quality control procedures. The original label was 'E159A'. Wed May 02 16:15:38 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu159ala' Tue Jun 30 18:43:37 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu159Ala' Q14213:p.Asp210Ala D210A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain D A This feature has been corrected as a result of our quality control procedures. The original label was 'D210A'. Wed May 02 15:13:11 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp210ala' Tue Jun 30 18:55:11 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp210Ala' Q14213:p.Phe97Ala F97A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain F A This feature has been corrected as a result of our quality control procedures. The original label was 'F97A'. Wed May 02 18:24:09 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe97ala' Tue Jun 30 17:27:34 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe97Ala' chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey 4 unspecified role unspecified role prey prey V5-tag V5-tag v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey physical association physical association