DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Subtle alterations in PCNA-partner interactions severely impair DNA replication and repair. Subtle alterations in PCNA-partner interactions severely impair DNA replication and repair. PLoS biology 2010 imex curation Fridman Y., Palgi N., Dovrat D., Ben-Aroya S., Hieter P., Aharoni A. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Fridman Y., Palgi N., Dovrat D., Ben-Aroya S., Hieter P., Aharoni A. DIP original experiment: DIP-216678X PLoS biology 2010 IMEx Subtle alterations in PCNA-partner interactions severely impair DNA replication and repair. Subtle alterations in PCNA-partner interactions severely impair DNA replication and repair. Subtle alterations in PCNA-partner interactions severely impair DNA replication and repair. PLoS biology 2010 imex curation Fridman Y., Palgi N., Dovrat D., Ben-Aroya S., Hieter P., Aharoni A. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Fridman Y., Palgi N., Dovrat D., Ben-Aroya S., Hieter P., Aharoni A. DIP original experiment: DIP-216687X PLoS biology 2010 IMEx Subtle alterations in PCNA-partner interactions severely impair DNA replication and repair. Subtle alterations in PCNA-partner interactions severely impair DNA replication and repair. Subtle alterations in PCNA-partner interactions severely impair DNA replication and repair. PLoS biology 2010 imex curation Fridman Y., Palgi N., Dovrat D., Ben-Aroya S., Hieter P., Aharoni A. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast solid phase assay solid phase assay elisa enzyme linked immunosorbent assay ELISA ELISA elisa Fridman Y., Palgi N., Dovrat D., Ben-Aroya S., Hieter P., Aharoni A. DIP original experiment: DIP-216680X PLoS biology 2010 IMEx Subtle alterations in PCNA-partner interactions severely impair DNA replication and repair. Subtle alterations in PCNA-partner interactions severely impair DNA replication and repair. Subtle alterations in PCNA-partner interactions severely impair DNA replication and repair. PLoS biology 2010 imex curation Fridman Y., Palgi N., Dovrat D., Ben-Aroya S., Hieter P., Aharoni A. Only protein-protein interactions in vitro In vitro solid phase assay solid phase assay predetermined predetermined participant predetermined Fridman Y., Palgi N., Dovrat D., Ben-Aroya S., Hieter P., Aharoni A. DIP original experiment: DIP-216681X PLoS biology 2010 IMEx Subtle alterations in PCNA-partner interactions severely impair DNA replication and repair. Subtle alterations in PCNA-partner interactions severely impair DNA replication and repair. Subtle alterations in PCNA-partner interactions severely impair DNA replication and repair. PLoS biology 2010 imex curation Fridman Y., Palgi N., Dovrat D., Ben-Aroya S., Hieter P., Aharoni A. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Fridman Y., Palgi N., Dovrat D., Ben-Aroya S., Hieter P., Aharoni A. DIP original experiment: DIP-216668X PLoS biology 2010 IMEx Subtle alterations in PCNA-partner interactions severely impair DNA replication and repair. Subtle alterations in PCNA-partner interactions severely impair DNA replication and repair. Subtle alterations in PCNA-partner interactions severely impair DNA replication and repair. PLoS biology 2010 imex curation Fridman Y., Palgi N., Dovrat D., Ben-Aroya S., Hieter P., Aharoni A. Only protein-protein interactions in vitro In vitro solid phase assay solid phase assay predetermined predetermined participant predetermined Fridman Y., Palgi N., Dovrat D., Ben-Aroya S., Hieter P., Aharoni A. DIP original experiment: DIP-216683X PLoS biology 2010 IMEx Subtle alterations in PCNA-partner interactions severely impair DNA replication and repair. Subtle alterations in PCNA-partner interactions severely impair DNA replication and repair. Subtle alterations in PCNA-partner interactions severely impair DNA replication and repair. PLoS biology 2010 imex curation Fridman Y., Palgi N., Dovrat D., Ben-Aroya S., Hieter P., Aharoni A. Only protein-protein interactions in vitro In vitro solid phase assay solid phase assay predetermined predetermined participant predetermined Fridman Y., Palgi N., Dovrat D., Ben-Aroya S., Hieter P., Aharoni A. DIP original experiment: DIP-216684X PLoS biology 2010 IMEx Subtle alterations in PCNA-partner interactions severely impair DNA replication and repair. Subtle alterations in PCNA-partner interactions severely impair DNA replication and repair. Subtle alterations in PCNA-partner interactions severely impair DNA replication and repair. PLoS biology 2010 imex curation Fridman Y., Palgi N., Dovrat D., Ben-Aroya S., Hieter P., Aharoni A. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Fridman Y., Palgi N., Dovrat D., Ben-Aroya S., Hieter P., Aharoni A. DIP original experiment: DIP-216677X PLoS biology 2010 IMEx Subtle alterations in PCNA-partner interactions severely impair DNA replication and repair. Subtle alterations in PCNA-partner interactions severely impair DNA replication and repair. Subtle alterations in PCNA-partner interactions severely impair DNA replication and repair. PLoS biology 2010 imex curation Fridman Y., Palgi N., Dovrat D., Ben-Aroya S., Hieter P., Aharoni A. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Fridman Y., Palgi N., Dovrat D., Ben-Aroya S., Hieter P., Aharoni A. DIP original experiment: DIP-216686X PLoS biology 2010 IMEx Subtle alterations in PCNA-partner interactions severely impair DNA replication and repair. Subtle alterations in PCNA-partner interactions severely impair DNA replication and repair. Subtle alterations in PCNA-partner interactions severely impair DNA replication and repair. PLoS biology 2010 imex curation Fridman Y., Palgi N., Dovrat D., Ben-Aroya S., Hieter P., Aharoni A. Only protein-protein interactions in vitro In vitro solid phase assay solid phase assay predetermined predetermined participant predetermined Fridman Y., Palgi N., Dovrat D., Ben-Aroya S., Hieter P., Aharoni A. DIP original experiment: DIP-216682X PLoS biology 2010 IMEx Subtle alterations in PCNA-partner interactions severely impair DNA replication and repair. Subtle alterations in PCNA-partner interactions severely impair DNA replication and repair. Subtle alterations in PCNA-partner interactions severely impair DNA replication and repair. PLoS biology 2010 imex curation Fridman Y., Palgi N., Dovrat D., Ben-Aroya S., Hieter P., Aharoni A. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast solid phase assay solid phase assay elisa enzyme linked immunosorbent assay ELISA ELISA elisa Fridman Y., Palgi N., Dovrat D., Ben-Aroya S., Hieter P., Aharoni A. DIP original experiment: DIP-216690X PLoS biology 2010 IMEx Subtle alterations in PCNA-partner interactions severely impair DNA replication and repair. Subtle alterations in PCNA-partner interactions severely impair DNA replication and repair. Subtle alterations in PCNA-partner interactions severely impair DNA replication and repair. PLoS biology 2010 imex curation Fridman Y., Palgi N., Dovrat D., Ben-Aroya S., Hieter P., Aharoni A. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Fridman Y., Palgi N., Dovrat D., Ben-Aroya S., Hieter P., Aharoni A. DIP original experiment: DIP-216671X PLoS biology 2010 IMEx Subtle alterations in PCNA-partner interactions severely impair DNA replication and repair. Subtle alterations in PCNA-partner interactions severely impair DNA replication and repair. Subtle alterations in PCNA-partner interactions severely impair DNA replication and repair. PLoS biology 2010 imex curation Fridman Y., Palgi N., Dovrat D., Ben-Aroya S., Hieter P., Aharoni A. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Fridman Y., Palgi N., Dovrat D., Ben-Aroya S., Hieter P., Aharoni A. DIP original experiment: DIP-216676X PLoS biology 2010 IMEx Subtle alterations in PCNA-partner interactions severely impair DNA replication and repair. Subtle alterations in PCNA-partner interactions severely impair DNA replication and repair. Subtle alterations in PCNA-partner interactions severely impair DNA replication and repair. PLoS biology 2010 imex curation Fridman Y., Palgi N., Dovrat D., Ben-Aroya S., Hieter P., Aharoni A. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast solid phase assay solid phase assay elisa enzyme linked immunosorbent assay ELISA ELISA elisa Fridman Y., Palgi N., Dovrat D., Ben-Aroya S., Hieter P., Aharoni A. DIP original experiment: DIP-216691X PLoS biology 2010 IMEx Subtle alterations in PCNA-partner interactions severely impair DNA replication and repair. Subtle alterations in PCNA-partner interactions severely impair DNA replication and repair. Subtle alterations in PCNA-partner interactions severely impair DNA replication and repair. PLoS biology 2010 imex curation Fridman Y., Palgi N., Dovrat D., Ben-Aroya S., Hieter P., Aharoni A. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Fridman Y., Palgi N., Dovrat D., Ben-Aroya S., Hieter P., Aharoni A. DIP original experiment: DIP-216672X PLoS biology 2010 IMEx Subtle alterations in PCNA-partner interactions severely impair DNA replication and repair. Subtle alterations in PCNA-partner interactions severely impair DNA replication and repair. Subtle alterations in PCNA-partner interactions severely impair DNA replication and repair. PLoS biology 2010 imex curation Fridman Y., Palgi N., Dovrat D., Ben-Aroya S., Hieter P., Aharoni A. Only protein-protein interactions in vitro In vitro solid phase assay solid phase assay predetermined predetermined participant predetermined Fridman Y., Palgi N., Dovrat D., Ben-Aroya S., Hieter P., Aharoni A. DIP original experiment: DIP-216685X PLoS biology 2010 IMEx Subtle alterations in PCNA-partner interactions severely impair DNA replication and repair. Subtle alterations in PCNA-partner interactions severely impair DNA replication and repair. Subtle alterations in PCNA-partner interactions severely impair DNA replication and repair. PLoS biology 2010 imex curation Fridman Y., Palgi N., Dovrat D., Ben-Aroya S., Hieter P., Aharoni A. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Fridman Y., Palgi N., Dovrat D., Ben-Aroya S., Hieter P., Aharoni A. DIP original experiment: DIP-216674X PLoS biology 2010 IMEx Subtle alterations in PCNA-partner interactions severely impair DNA replication and repair. Subtle alterations in PCNA-partner interactions severely impair DNA replication and repair. Subtle alterations in PCNA-partner interactions severely impair DNA replication and repair. PLoS biology 2010 imex curation Fridman Y., Palgi N., Dovrat D., Ben-Aroya S., Hieter P., Aharoni A. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Fridman Y., Palgi N., Dovrat D., Ben-Aroya S., Hieter P., Aharoni A. DIP original experiment: DIP-216675X PLoS biology 2010 IMEx Subtle alterations in PCNA-partner interactions severely impair DNA replication and repair. Subtle alterations in PCNA-partner interactions severely impair DNA replication and repair. Subtle alterations in PCNA-partner interactions severely impair DNA replication and repair. PLoS biology 2010 imex curation Fridman Y., Palgi N., Dovrat D., Ben-Aroya S., Hieter P., Aharoni A. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Fridman Y., Palgi N., Dovrat D., Ben-Aroya S., Hieter P., Aharoni A. DIP original experiment: DIP-216688X PLoS biology 2010 IMEx Subtle alterations in PCNA-partner interactions severely impair DNA replication and repair. Subtle alterations in PCNA-partner interactions severely impair DNA replication and repair. Subtle alterations in PCNA-partner interactions severely impair DNA replication and repair. PLoS biology 2010 imex curation Fridman Y., Palgi N., Dovrat D., Ben-Aroya S., Hieter P., Aharoni A. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast solid phase assay solid phase assay elisa enzyme linked immunosorbent assay ELISA ELISA elisa Fridman Y., Palgi N., Dovrat D., Ben-Aroya S., Hieter P., Aharoni A. DIP original experiment: DIP-216679X PLoS biology 2010 IMEx Subtle alterations in PCNA-partner interactions severely impair DNA replication and repair. Subtle alterations in PCNA-partner interactions severely impair DNA replication and repair. Subtle alterations in PCNA-partner interactions severely impair DNA replication and repair. PLoS biology 2010 imex curation Fridman Y., Palgi N., Dovrat D., Ben-Aroya S., Hieter P., Aharoni A. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Fridman Y., Palgi N., Dovrat D., Ben-Aroya S., Hieter P., Aharoni A. DIP original experiment: DIP-216673X PLoS biology 2010 IMEx Subtle alterations in PCNA-partner interactions severely impair DNA replication and repair. Subtle alterations in PCNA-partner interactions severely impair DNA replication and repair. Subtle alterations in PCNA-partner interactions severely impair DNA replication and repair. PLoS biology 2010 imex curation Fridman Y., Palgi N., Dovrat D., Ben-Aroya S., Hieter P., Aharoni A. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Fridman Y., Palgi N., Dovrat D., Ben-Aroya S., Hieter P., Aharoni A. DIP original experiment: DIP-216667X PLoS biology 2010 IMEx Subtle alterations in PCNA-partner interactions severely impair DNA replication and repair. Subtle alterations in PCNA-partner interactions severely impair DNA replication and repair. Subtle alterations in PCNA-partner interactions severely impair DNA replication and repair. PLoS biology 2010 imex curation Fridman Y., Palgi N., Dovrat D., Ben-Aroya S., Hieter P., Aharoni A. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Fridman Y., Palgi N., Dovrat D., Ben-Aroya S., Hieter P., Aharoni A. DIP original experiment: DIP-216669X PLoS biology 2010 IMEx Subtle alterations in PCNA-partner interactions severely impair DNA replication and repair. Subtle alterations in PCNA-partner interactions severely impair DNA replication and repair. Subtle alterations in PCNA-partner interactions severely impair DNA replication and repair. PLoS biology 2010 imex curation Fridman Y., Palgi N., Dovrat D., Ben-Aroya S., Hieter P., Aharoni A. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Fridman Y., Palgi N., Dovrat D., Ben-Aroya S., Hieter P., Aharoni A. DIP original experiment: DIP-216670X PLoS biology 2010 IMEx Subtle alterations in PCNA-partner interactions severely impair DNA replication and repair. Subtle alterations in PCNA-partner interactions severely impair DNA replication and repair. Subtle alterations in PCNA-partner interactions severely impair DNA replication and repair. PLoS biology 2010 imex curation Fridman Y., Palgi N., Dovrat D., Ben-Aroya S., Hieter P., Aharoni A. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Fridman Y., Palgi N., Dovrat D., Ben-Aroya S., Hieter P., Aharoni A. DIP original experiment: DIP-216666X PLoS biology 2010 IMEx Subtle alterations in PCNA-partner interactions severely impair DNA replication and repair. Subtle alterations in PCNA-partner interactions severely impair DNA replication and repair. Subtle alterations in PCNA-partner interactions severely impair DNA replication and repair. PLoS biology 2010 imex curation Fridman Y., Palgi N., Dovrat D., Ben-Aroya S., Hieter P., Aharoni A. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Fridman Y., Palgi N., Dovrat D., Ben-Aroya S., Hieter P., Aharoni A. DIP original experiment: DIP-216689X PLoS biology 2010 IMEx Subtle alterations in PCNA-partner interactions severely impair DNA replication and repair. dnli1_yeast DNA ligase 1 YDL164C CDC9 DNA ligase I Polydeoxyribonucleotide synthase [ATP] 1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MRRLLTGCLLSSARPLKSRLPLLMSSSLPSSAGKKPKQATLARFFTSMKNKPTEGTPSPKKSSKHMLEDRMDNVSGEEEYATKKLKQTAVTHTVAAPSSMGSNFSSIPSSAPSSGVADSPQQSQRLVGEVEDALSSNNNDHYSSNIPYSEVCEVFNKIEAISSRLEIIRICSDFFIKIMKQSSKNLIPTTYLFINRLGPDYEAGLELGLGENLLMKTISETCGKSMSQIKLKYKDIGDLGEIAMGARNVQPTMFKPKPLTVGEVFKNLRAIAKTQGKDSQLKKMKLIKRMLTACKGIEAKFLIRSLESKLRIGLAEKTVLISLSKALLLHDENREDSPDKDVPMDVLESAQQKIRDAFCQVPNYEIVINSCLEHGIMNLDKYCTLRPGIPLKPMLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLNDGTMRIYSRNGENMTERYPEINITDFIQDLDTTKNLILDCEAVAWDKDQGKILPFQVLSTRKRKDVELNDVKVKVCLFAFDILCYNDERLINKSLKERREYLTKVTKVVPGEFQYATQITTNNLDELQKFLDESVNHSCEGLMVKMLEGPESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLGAYYGRGKRTGTYGGFLLGCYNQDTGEFETCCKIGTGFSDEMLQLLHDRLTPTIIDGPKATFVFDSSAEPDVWFEPTTLFEVLTADLSLSPIYKAGSATFDKGVSLRFPRFLRIREDKGVEDATSSDQIVELYENQSHMQN B7C2ECAF5C61CAE7 B7C2ECAF5C61CAE7 rrm3_yeast ATP-dependent DNA helicase RRM3 RRM3 rDNA recombination mutation protein 3 RTT104 Regulation of Ty1 transposition protein 104 YHR031C protein protein yeast Saccharomyces cerevisiae Baker's yeast MFRSHASGNKKQWSKRSSNGSTPAASASGSHAYRQQTLSSFFMGCGKKSAAASKNSTTIIDLESGDEGNRNITAPPRPRLIRNNSSSLFSQSQGSFGDDDPDAEFKKLVDVPRLNSYKKSSRSLSMTSSLHKTASASTTQKTYHFDEDETLREVTSVKSNSRQLSFTSTINIEDSSMKLSTDSERPAKRSKPSMEFQGLKLTVPKKIKPLLRKTVSNMDSMNHRSASSPVVLTMEQERVVNLIVKKRTNVFYTGSAGTGKSVILQTIIRQLSSLYGKESIAITASTGLAAVTIGGSTLHKWSGIGIGNKTIDQLVKKIQSQKDLLAAWRYTKVLIIDEISMVDGNLLDKLEQIARRIRKNDDPFGGIQLVLTGDFFQLPPVAKKDEHNVVKFCFESEMWKRCIQKTILLTKVFRQQDNKLIDILNAIRYGELTVDIAKTIRNLNRDIDYADGIAPTELYATRREVELSNVKKLQSLPGDLYEFKAVDNAPERYQAILDSSLMVEKVVALKEDAQVMMLKNKPDVELVNGSLGKVLFFVTESLVVKMKEIYKIVDDEVVMDMRLVSRVIGNPLLKESKEFRQDLNARPLARLERLKILINYAVKISPHKEKFPYVRWTVGKNKYIHELMVPERFPIDIPRENVGLERTQIPLMLCWALSIHKAQGQTIQRLKVDLRRIFEAGQVYVALSRAVTMDTLQVLNFDPGKIRTNERVKDFYKRLETLK 8E0010ABB870CAB6 8E0010ABB870CAB6 eco1_yeast N-acetyltransferase ECO1 ECO1 CTF7 YFR027W Establishment of cohesion protein 1 Chromosome transmission fidelity protein 7 protein protein yeast Saccharomyces cerevisiae Baker's yeast MKARKSQRKAGSKPNLIQSKLQVNNGSKSNKIVKCDKCEMSYSSTSIEDRAIHEKYHTLQLHGRKWSPNWGSIVYTERNHSRTVHLSRSTGTITPLNSSPLKKSSPSITHQEEKIVYVRPDKSNGEVRAMTEIMTLVNNELNAPHDENVIWNSTTEEKGKAFVYIRNDRAVGIIIIENLYGGNGKTSSRGRWMVYDSRRLVQNVYPDFKIGISRIWVCRTARKLGIATKLIDVARENIVYGEVIPRYQVAWSQPTDSGGKLASKYNGIMHKSGKLLLPVYI 0AF1B59BE9E71818 0AF1B59BE9E71818 apn2_yeast DNA-(apurinic or apyrimidinic site) endonuclease 2 APN2 ETH1 YBL019W YBL0443 AP endonuclease 2 Apurinic-apyrimidinic endonuclease 2 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSSSENTLLDGKSENTIRFLTFNVNGIRTFFHYQPFSQMNQSLRSVFDFFRADIITFQELKTEKLSISKWGRVDGFYSFISIPQTRKGYSGVGCWIRIPEKNHPLYHALQVVKAEEGITGYLTIKNGKHSAISYRNDVNQGIGGYDSLDPDLDEKSALELDSEGRCVMVELACGIVIISVYCPANSNSSEEGEMFRLRFLKVLLRRVRNLDKIGKKIVLMGDVNVCRDLIDSADTLEQFSIPITDPMGGTKLEAQYRDKAIQFIINPDTPHRRIFNQILADSLLPDASKRGILIDTTRLIQTRNRLKMYTVWNMLKNLRPSNYGSRIDFILVSLKLERCIKAADILPDILGSDHCPVYSDLDILDDRIEPGTTQVPIPKFEARYKYNLRNHNVLEMFAKKDTNKESNKQKYCVSKVMNTKKNSNIKNKSLDSFFQKVNGEKDDRIKESSEIPQQAKKRISTPKLNFKDVFGKPPLCRHGEESMLKTSKTSANPGRKFWICKRSRGDSNNTESSCGFFQWV E3947C4D904C53FB E3947C4D904C53FB dpod3_yeast DNA polymerase delta subunit 3 POL32 J1626 YJR043C protein protein yeast Saccharomyces cerevisiae Baker's yeast MDQKASYFINEKLFTEVKPVLFTDLIHHLKIGPSMAKKLMFDYYKQTTNAKYNCVVICCYKDQTIKIIHDLSNIPQQDSIIDCFIYAFNPMDSFIPYYDIIDQKDCLTIKNSYELKVSESSKIIERTKTLEEKSKPLVRPTARSKTTPEETTGRKSKSKDMGLRSTALLAKMKKDRDDKETSRQNELRKRKEENLQKINKQNPEREAQMKELNNLFVEDDLDTEEVNGGSKPNSPKETDSNDKDKNNDDLEDLLETTAEDSLMDVPKIQQTKPSETEHSKEPKSEEEPSSFIDEDGYIVTKRPATSTPPRKPSPVVKRALSSSKKQETPSSNKRLKKQGTLESFFKRKAK D0B9CC52F26E20B2 D0B9CC52F26E20B2 ung_yeast Uracil-DNA glycosylase UNG1 YML021C protein protein yeast Saccharomyces cerevisiae Baker's yeast MWCMRRLPTNSVMTVARKRKQTTIEDFFGTKKSTNEAPNKKGKSGATFMTITNGAAIKTETKAVAKEANTDKYPANSNAKDVYSKNLSSNLRTLLSLELETIDDSWFPHLMDEFKKPYFVKLKQFVTKEQADHTVFPPAKDIYSWTRLTPFNKVKVVIIGQDPYHNFNQAHGLAFSVKPPTPAPPSLKNIYKELKQEYPDFVEDNKVGDLTHWASQGVLLLNTSLTVRAHNANSHSKHGWETFTKRVVQLLIQDREADGKSLVFLLWGNNAIKLVESLLGSTSVGSGSKYPNIMVMKSVHPSPLSASRGFFGTNHFKMINDWLYNTRGEKMIDWSVVPGTSLREVQEANARLESESKDP CC06971E05FE7751 CC06971E05FE7751 msh3_yeast DNA mismatch repair protein MSH3 MSH3 YCR092C YCR92C YCR1152 MutS protein homolog 3 Mismatch-binding protein protein protein yeast Saccharomyces cerevisiae Baker's yeast MAGQPTISRFFKKAVKSELTHKQEQEVAVGNGAGSESICLDTDEEDNLSSVASTTVTNDSFPLKGSVSSKNSKNSEKTSGTSTTFNDIDFAKKLDRIMKRRSDENVEAEDDEEEGEEDFVKKKARKSPTAKLTPLDKQVKDLKMHHRDKVLVIRVGYKYKCFAEDAVTVSRILHIKLVPGKLTIDESNPQDCNHRQFAYCSFPDVRLNVHLERLVHHNLKVAVVEQAETSAIKKHDPGASKSSVFERKISNVFTKATFGVNSTFVLRGKRILGDTNSIWALSRDVHQGKVAKYSLISVNLNNGEVVYDEFEEPNLADEKLQIRIKYLQPIEVLVNTDDLPLHVAKFFKDISCPLIHKQEYDLEDHVVQAIKVMNEKIQLSPSLIRLVSKLYSHMVEYNNEQVMLIPSIYSPFASKIHMLLDPNSLQSLDIFTHDGGKGSLFWLLDHTRTSFGLRMLREWILKPLVDVHQIEERLDAIECITSEINNSIFFESLNQMLNHTPDLLRTLNRIMYGTTSRKEVYFYLKQITSFVDHFKMHQSYLSEHFKSSDGRIGKQSPLLFRLFSELNELLSTTQLPHFLTMINVSAVMEKNSDKQVMDFFNLNNYDCSEGIIKIQRESESVRSQLKEELAEIRKYLKRPYLNFRDEVDYLIEVKNSQIKDLPDDWIKVNNTKMVSRFTTPRTQKLTQKLEYYKDLLIRESELQYKEFLNKITAEYTELRKITLNLAQYDCILSLAATSCNVNYVRPTFVNGQQAIIAKNARNPIIESLDVHYVPNDIMMSPENGKINIITGPNMGGKSSYIRQVALLTIMAQIGSFVPAEEIRLSIFENVLTRIGAHDDIINGDSTFKVEMLDILHILKNCNKRSLLLLDEVGRGTGTHDGIAISYALIKYFSELSDCPLILFTTHFPMLGEIKSPLIRNYHMDYVEEQKTGEDWMSVIFLYKLKKGLTYNSYGMNVAKLARLDKDIINRAFSISEELRKESINEDALKLFSSLKRILKSDNITATDKLAKLLSLDIH 1AD91C2E2F2856EF 1AD91C2E2F2856EF msh6_yeast DNA mismatch repair protein MSH6 MSH6 YDR097C YD8557.04C PMS3 MutS protein homolog 6 Postmeiotic segregation protein 3 protein protein yeast Saccharomyces cerevisiae Baker's yeast MAPATPKTSKTAHFENGSTSSQKKMKQSSLLSFFSKQVPSGTPSKKVQKPTPATLENTATDKITKNPQGGKTGKLFVDVDEDNDLTIAEETVSTVRSDIMHSQEPQSDTMLNSNTTEPKSTTTDEDLSSSQSRRNHKRRVNYAESDDDDSDTTFTAKRKKGKVVDSESDEDEYLPDKNDGDEDDDIADDKEDIKGELAEDSGDDDDLISLAETTSKKKFSYNTSHSSSPFTRNISRDNSKKKSRPNQAPSRSYNPSHSQPSATSKSSKFNKQNEERYQWLVDERDAQRRPKSDPEYDPRTLYIPSSAWNKFTPFEKQYWEIKSKMWDCIVFFKKGKFFELYEKDALLANALFDLKIAGGGRANMQLAGIPEMSFEYWAAQFIQMGYKVAKVDQRESMLAKEMREGSKGIVKRELQCILTSGTLTDGDMLHSDLATFCLAIREEPGNFYNETQLDSSTIVQKLNTKIFGAAFIDTATGELQMLEFEDDSECTKLDTLMSQVRPMEVVMERNNLSTLANKIVKFNSAPNAIFNEVKAGEEFYDCDKTYAEIISSEYFSTEEDWPEVLKSYYDTGKKVGFSAFGGLLYYLKWLKLDKNLISMKNIKEYDFVKSQHSMVLDGITLQNLEIFSNSFDGSDKGTLFKLFNRAITPMGKRMMKKWLMHPLLRKNDIESRLDSVDSLLQDITLREQLEITFSKLPDLERMLARIHSRTIKVKDFEKVITAFETIIELQDSLKNNDLKGDVSKYISSFPEGLVEAVKSWTNAFERQKAINENIIVPQRGFDIEFDKSMDRIQELEDELMEILMTYRKQFKCSNIQYKDSGKEIYTIEIPISATKNVPSNWVQMAANKTYKRYYSDEVRALARSMAEAKEIHKTLEEDLKNRLCQKFDAHYNTIWMPTIQAISNIDCLLAITRTSEYLGAPSCRPTIVDEVDSKTNTQLNGFLKFKSLRHPCFNLGATTAKDFIPNDIELGKEQPRLGLLTGANAAGKSTILRMACIAVIMAQMGCYVPCESAVLTPIDRIMTRLGANDNIMQGKSTFFVELAETKKILDMATNRSLLVVDELGRGGSSSDGFAIAESVLHHVATHIQSLGFFATHYGTLASSFKHHPQVRPLKMSILVDEATRNVTFLYKMLEGQSEGSFGMHVASMCGISKEIIDNAQIAADNLEHTSRLVKERDLAANNLNGEVVSVPGGLQSDFVRIAYGDGLKNTKLGSGEGVLNYDWNIKRNVLKSLFSIIDDLQS 11A6883AADCFA222 11A6883AADCFA222 fen1_yeast Flap endonuclease 1 RAD27 RTH1 YKL113C YKL510 FEN1 Flap structure-specific endonuclease 1 RAD2 homolog nuclease 1 Structure-specific endonuclease RAD27 protein protein yeast Saccharomyces cerevisiae Baker's yeast MGIKGLNAIISEHVPSAIRKSDIKSFFGRKVAIDASMSLYQFLIAVRQQDGGQLTNEAGETTSHLMGMFYRTLRMIDNGIKPCYVFDGKPPDLKSHELTKRSSRRVETEKKLAEATTELEKMKQERRLVKVSKEHNEEAQKLLGLMGIPYIIAPTEAEAQCAELAKKGKVYAAASEDMDTLCYRTPFLLRHLTFSEAKKEPIHEIDTELVLRGLDLTIEQFVDLCIMLGCDYCESIRGVGPVTALKLIKTHGSIEKIVEFIESGESNNTKWKIPEDWPYKQARMLFLDPEVIDGNEINLKWSPPKEKELIEYLCDDKKFSEERVKSGISRLKKGLKSGIQGRLDGFFQVVPKTKEQLAAAAKRAQENKKLNKNKNKVTKGRR 1F54B08720121C8C 1F54B08720121C8C rlf2_yeast Chromatin assembly factor 1 subunit p90 RLF2 CAC1 YPR018W YP9531.12 CAF-1 90 kDa subunit RAP1 localization factor 2 protein protein yeast Saccharomyces cerevisiae Baker's yeast MEQHLKSIPLQDDTKKKGILSFFQNTTTVKSNKFLTKEKDVITLDDPKEDVSGPMIETVKQETMKSINKECADEMKTTPKKANAEDKLLCYKNSPIQSTKYDRNTNKQVPNGNIIAIETKSRSSSPCSKRELSSSKKEEAKREKELKKQQRAEEKHRKELLRQEEKKKKELKVEEERQRRAELKKQKEEEKRRKEEARLEAKRRKEEERLKKEEEIRLKEEAKERAQSRIGNFFKKLSDSNTPVVEKSDYEKFFLPFYAKDGVRVSNKWKLTKVELEGSKRKIDDELLNSKDKTSSDDLLNWLQSRRLPRGHKIKRKAVDVLQQMPLKEKTDDELQSLLAQVPHKYIKFYENVRPPFIGTYSMDFTLPPNDPFSTKGTGFNYDYDSDVEWVNEEEEGEVDNLESGEEEEEEEDDEDVPSEGEFDGFLDSEENSDLDGLPCAKRKFVGPLIPTICLKSNFENLSEENKRYLQQLKAEVIIETDGPIDPFKEPKTSSLPSKRSNSDLQAQTASQSQSPEKKQKAMITDPMDLLRLFDGVQDSTFSLGTVTEIAQKNLPQYNKQTIKNTIKEYAIRSSGKGDLPRKWVIKDAQNWENLRANANMPTPSL C593E6E4FE5FD778 C593E6E4FE5FD778 pcna_yeast Proliferating cell nuclear antigen YBR0811 YBR088C POL30 protein protein yeast Saccharomyces cerevisiae Baker's yeast MLEAKFEEASLFKRIIDGFKDCVQLVNFQCKEDGIIAQAVDDSRVLLVSLEIGVEAFQEYRCDHPVTLGMDLTSLSKILRCGNNTDTLTLIADNTPDSIILLFEDTKKDRIAEYSLKLMDIDADFLKIEELQYDSTLSLPSSEFSKIVRDLSQLSDSINIMITKETIKFVADGDIGSGSVIIKPFVDMEHPETSIKLEMDQPVDLTFGAKYLLDIIKGSSLSDRVGIRLSSEAPALFQFDLKSGFLQFFLAPKFNDEE 9B56C5851621DDDC 9B56C5851621DDDC rfc1_yeast Replication factor C subunit 1 RFC1 CDC44 YOR217W YOR50-7 Activator 1 95 kDa subunit Cell division control protein 44 protein protein yeast Saccharomyces cerevisiae Baker's yeast MVNISDFFGKNKKSVRSSTSRPTRQVGSSKPEVIDLDTESDQESTNKTPKKMPVSNVIDVSETPEGEKKLPLPAKRKASSPTVKPASSKKTKPSSKSSDSASNITAQDVLDKIPSLDLSNVHVKENAKFDFKSANSNADPDEIVSEIGSFPEGKPNCLLGLTIVFTGVLPTLERGASEALAKRYGARVTKSISSKTSVVVLGDEAGPKKLEKIKQLKIKAIDEEGFKQLIAGMPAEGGDGEAAEKARRKLEEQHNIATKEAELLVKKEEERSKKLAATRVSGGHLERDNVVREEDKLWTVKYAPTNLQQVCGNKGSVMKLKNWLANWENSKKNSFKHAGKDGSGVFRAAMLYGPPGIGKTTAAHLVAQELGYDILEQNASDVRSKTLLNAGVKNALDNMSVVGYFKHNEEAQNLNGKHFVIIMDEVDGMSGGDRGGVGQLAQFCRKTSTPLILICNERNLPKMRPFDRVCLDIQFRRPDANSIKSRLMTIAIREKFKLDPNVIDRLIQTTRGDIRQVINLLSTISTTTKTINHENINEISKAWEKNIALKPFDIAHKMLDGQIYSDIGSRNFTLNDKIALYFDDFDFTPLMIQENYLSTRPSVLKPGQSHLEAVAEAANCISLGDIVEKKIRSSEQLWSLLPLHAVLSSVYPASKVAGHMAGRINFTAWLGQNSKSAKYYRLLQEIHYHTRLGTSTDKIGLRLDYLPTFRKRLLDPFLKQGADAISSVIEVMDDYYLTKEDWDSIMEFFVGPDVTTAIIKKIPATVKSGFTRKYNSMTHPVAIYRTGSTIGGGGVGTSTSTPDFEDVVDADDNPVPADDEETQDSSTDLKKDKLIKQKAKPTKRKTATSKPGGSKKRKTKA A7D9208D66DD9A98 A7D9208D66DD9A98 polh_yeast DNA polymerase eta RAD30 DBH1 YDR419W Radiation-sensitive protein 30 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSKFTWKELIQLGSPSKAYESSLACIAHIDMNAFFAQVEQMRCGLSKEDPVVCVQWNSIIAVSYAARKYGISRMDTIQEALKKCSNLIPIHTAVFKKGEDFWQYHDGCGSWVQDPAKQISVEDHKVSLEPYRRESRKALKIFKSACDLVERASIDEVFLDLGRICFNMLMFDNEYELTGDLKLKDALSNIREAFIGGNYDINSHLPLIPEKIKSLKFEGDVFNPEGRDLITDWDDVILALGSQVCKGIRDSIKDILGYTTSCGLSSTKNVCKLASNYKKPDAQTIVKNDCLLDFLDCGKFEITSFWTLGGVLGKELIDVLDLPHENSIKHIRETWPDNAGQLKEFLDAKVKQSDYDRSTSNIDPLKTADLAEKLFKLSRGRYGLPLSSRPVVKSMMSNKNLRGKSCNSIVDCISWLEVFCAELTSRIQDLEQEYNKIVIPRTVSISLKTKSYEVYRKSGPVAYKGINFQSHELLKVGIKFVTDLDIKGKNKSYYPLTKLSMTITNFDIIDLQKTVVDMFGNQVHTFKSSAGKEDEEKTTSSKADEKTPKLECCKYQVTFTDQKALQEHADYHLALKLSEGLNGAEESSKNLSFGEKRLLFSRKRPNSQHTATPQKKQVTSSKNILSFFTRKK CFB1A9FBC8AFE39B CFB1A9FBC8AFE39B pcna-rad30-4 25 39 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 37 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association pcna-msh6-1 19 34 unspecified role unspecified role prey prey PIP domain Region 20-38 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain in vitro In vitro 37 unspecified role unspecified role bait bait ecolx Escherichia coli direct interaction direct interaction pcna-apn2-1 8 30 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 37 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association pcna-rad27-1 22 35 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 37 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association pcna-rad30-5 20 39 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 37 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association pcna-pol32-1 2 31 unspecified role unspecified role prey prey PIP domain Region 331-349 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain in vitro In vitro 37 unspecified role unspecified role bait bait ecolx Escherichia coli direct interaction direct interaction pcna-12 1 37 unspecified role unspecified role unspecified role unspecified role P15873:p.Ser115Pro S115P mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain S P This feature has been corrected as a result of our quality control procedures. The original label was 'S115P'. Wed May 02 18:15:55 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser115pro' Tue Jun 30 20:25:08 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser115Pro' ecolx Escherichia coli direct interaction direct interaction pcna-pol32-2 5 31 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 37 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association pcna-msh6-2 11 34 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 37 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association pcna-rad27-2 3 35 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 37 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association pcna-msh6-3 23 34 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 37 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association pcna-ung1-1 14 32 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 37 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association pcna-ung1-2 24 32 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 37 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association pcna-ung1-3 26 32 unspecified role unspecified role prey prey PIP domain Region 14-32 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain in vitro In vitro 37 unspecified role unspecified role bait bait ecolx Escherichia coli direct interaction direct interaction pcna-cdc9-1 12 27 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 37 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association rad30-pcna-1 4 39 unspecified role unspecified role bait bait PIP domain Region 614-632 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain in vitro In vitro 37 unspecified role unspecified role prey prey ecolx Escherichia coli physical association physical association pcna-eco1-1 15 29 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 37 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association rad27-pcna-4 10 35 unspecified role unspecified role bait bait PIP domain Region 333-351 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain in vitro In vitro 37 unspecified role unspecified role prey prey ecolx Escherichia coli physical association physical association pcna-msh3-1 21 33 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 37 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association msh6-pcna-1 7 34 unspecified role unspecified role bait bait PIP domain Region 20-38 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain in vitro In vitro 37 unspecified role unspecified role prey prey ecolx Escherichia coli physical association physical association pol32-pcna-1 6 31 unspecified role unspecified role bait bait PIP domain Region 331-349 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain in vitro In vitro 37 unspecified role unspecified role prey prey ecolx Escherichia coli physical association physical association ung1-pcna-1 16 32 unspecified role unspecified role bait bait PIP domain Region 14-32 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain in vitro In vitro 37 unspecified role unspecified role prey prey ecolx Escherichia coli physical association physical association pcna-rfc1-1 17 38 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 37 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association pcna-cac1-1 18 36 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 37 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association pcna-rad30-6 9 39 unspecified role unspecified role prey prey PIP domain Region 614-632 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain in vitro In vitro 37 unspecified role unspecified role bait bait ecolx Escherichia coli direct interaction direct interaction pcna-rrm3-1 13 28 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 37 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association