DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Autophagy protein microtubule-associated protein 1 light chain-3B (LC3B) activates extrinsic apoptosis during cigarette smoke-induced emphysema. Autophagy protein microtubule-associated protein 1 light chain-3B (LC3B) activates extrinsic apoptosis during cigarette smoke-induced emphysema. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Chen ZH., Lam HC., Jin Y., Kim HP., Cao J., Lee SJ., Ifedigbo E., Parameswaran H., Ryter SW., Choi AM. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Chen ZH., Lam HC., Jin Y., Kim HP., Cao J., Lee SJ., Ifedigbo E., Parameswaran H., Ryter SW., Choi AM. DIP original experiment: DIP-254119X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Autophagy protein microtubule-associated protein 1 light chain-3B (LC3B) activates extrinsic apoptosis during cigarette smoke-induced emphysema. Autophagy protein microtubule-associated protein 1 light chain-3B (LC3B) activates extrinsic apoptosis during cigarette smoke-induced emphysema. Autophagy protein microtubule-associated protein 1 light chain-3B (LC3B) activates extrinsic apoptosis during cigarette smoke-induced emphysema. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Chen ZH., Lam HC., Jin Y., Kim HP., Cao J., Lee SJ., Ifedigbo E., Parameswaran H., Ryter SW., Choi AM. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Chen ZH., Lam HC., Jin Y., Kim HP., Cao J., Lee SJ., Ifedigbo E., Parameswaran H., Ryter SW., Choi AM. DIP original experiment: DIP-254123X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Autophagy protein microtubule-associated protein 1 light chain-3B (LC3B) activates extrinsic apoptosis during cigarette smoke-induced emphysema. Autophagy protein microtubule-associated protein 1 light chain-3B (LC3B) activates extrinsic apoptosis during cigarette smoke-induced emphysema. Autophagy protein microtubule-associated protein 1 light chain-3B (LC3B) activates extrinsic apoptosis during cigarette smoke-induced emphysema. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Chen ZH., Lam HC., Jin Y., Kim HP., Cao J., Lee SJ., Ifedigbo E., Parameswaran H., Ryter SW., Choi AM. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Chen ZH., Lam HC., Jin Y., Kim HP., Cao J., Lee SJ., Ifedigbo E., Parameswaran H., Ryter SW., Choi AM. DIP original experiment: DIP-254122X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Autophagy protein microtubule-associated protein 1 light chain-3B (LC3B) activates extrinsic apoptosis during cigarette smoke-induced emphysema. Autophagy protein microtubule-associated protein 1 light chain-3B (LC3B) activates extrinsic apoptosis during cigarette smoke-induced emphysema. Autophagy protein microtubule-associated protein 1 light chain-3B (LC3B) activates extrinsic apoptosis during cigarette smoke-induced emphysema. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Chen ZH., Lam HC., Jin Y., Kim HP., Cao J., Lee SJ., Ifedigbo E., Parameswaran H., Ryter SW., Choi AM. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Chen ZH., Lam HC., Jin Y., Kim HP., Cao J., Lee SJ., Ifedigbo E., Parameswaran H., Ryter SW., Choi AM. DIP original experiment: DIP-254121X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Autophagy protein microtubule-associated protein 1 light chain-3B (LC3B) activates extrinsic apoptosis during cigarette smoke-induced emphysema. Autophagy protein microtubule-associated protein 1 light chain-3B (LC3B) activates extrinsic apoptosis during cigarette smoke-induced emphysema. Autophagy protein microtubule-associated protein 1 light chain-3B (LC3B) activates extrinsic apoptosis during cigarette smoke-induced emphysema. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Chen ZH., Lam HC., Jin Y., Kim HP., Cao J., Lee SJ., Ifedigbo E., Parameswaran H., Ryter SW., Choi AM. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Chen ZH., Lam HC., Jin Y., Kim HP., Cao J., Lee SJ., Ifedigbo E., Parameswaran H., Ryter SW., Choi AM. DIP original experiment: DIP-254117X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Autophagy protein microtubule-associated protein 1 light chain-3B (LC3B) activates extrinsic apoptosis during cigarette smoke-induced emphysema. Autophagy protein microtubule-associated protein 1 light chain-3B (LC3B) activates extrinsic apoptosis during cigarette smoke-induced emphysema. Autophagy protein microtubule-associated protein 1 light chain-3B (LC3B) activates extrinsic apoptosis during cigarette smoke-induced emphysema. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Chen ZH., Lam HC., Jin Y., Kim HP., Cao J., Lee SJ., Ifedigbo E., Parameswaran H., Ryter SW., Choi AM. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Chen ZH., Lam HC., Jin Y., Kim HP., Cao J., Lee SJ., Ifedigbo E., Parameswaran H., Ryter SW., Choi AM. DIP original experiment: DIP-254118X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Autophagy protein microtubule-associated protein 1 light chain-3B (LC3B) activates extrinsic apoptosis during cigarette smoke-induced emphysema. Autophagy protein microtubule-associated protein 1 light chain-3B (LC3B) activates extrinsic apoptosis during cigarette smoke-induced emphysema. Autophagy protein microtubule-associated protein 1 light chain-3B (LC3B) activates extrinsic apoptosis during cigarette smoke-induced emphysema. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Chen ZH., Lam HC., Jin Y., Kim HP., Cao J., Lee SJ., Ifedigbo E., Parameswaran H., Ryter SW., Choi AM. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Chen ZH., Lam HC., Jin Y., Kim HP., Cao J., Lee SJ., Ifedigbo E., Parameswaran H., Ryter SW., Choi AM. DIP original experiment: DIP-254116X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Autophagy protein microtubule-associated protein 1 light chain-3B (LC3B) activates extrinsic apoptosis during cigarette smoke-induced emphysema. Autophagy protein microtubule-associated protein 1 light chain-3B (LC3B) activates extrinsic apoptosis during cigarette smoke-induced emphysema. Autophagy protein microtubule-associated protein 1 light chain-3B (LC3B) activates extrinsic apoptosis during cigarette smoke-induced emphysema. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Chen ZH., Lam HC., Jin Y., Kim HP., Cao J., Lee SJ., Ifedigbo E., Parameswaran H., Ryter SW., Choi AM. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Chen ZH., Lam HC., Jin Y., Kim HP., Cao J., Lee SJ., Ifedigbo E., Parameswaran H., Ryter SW., Choi AM. DIP original experiment: DIP-254120X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Autophagy protein microtubule-associated protein 1 light chain-3B (LC3B) activates extrinsic apoptosis during cigarette smoke-induced emphysema. bid_human BH3-interacting domain death agonist p22 BID BID protein protein human Homo sapiens Human MDCEVNNGSSLRDECITNLLVFGFLQSCSDNSFRRELDALGHELPVLAPQWEGYDELQTDGNRSSHSRLGRIEADSESQEDIIRNIARHLAQVGDSMDRSIPPGLVNGLALQLRNTSRSEEDRNRDLATALEQLLQAYPRDMEKEKTMLVLALLLAKKVASHTPSLLRDVFHTTVNFINQNLRTYVRSLARNGMD DIP protein P55957 original sequence version: 105 DIP protein P55957 original sequence version: 114 DIP protein P55957-1 original sequence version: 132 DIP protein P55957 original sequence version: 144 B17A07334C1AFBEF cav1_human Caveolin-1 CAV1 CAV protein protein human Homo sapiens Human MSGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADELSEKQVYDAHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSALFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTVCDPLFEAVGKIFSNVRINLQKEI DIP protein Q03135 original sequence version: 164 DIP protein Q03135 original sequence version: 119 DIP protein Q03135 original sequence version: 122 DIP protein Q03135-1 original sequence version: 122 DIP protein Q03135 original sequence version: 133 DIP protein Q03135 original sequence version: 155 DIP protein Q03135 original sequence version: 147 2424DE9B5E6521D5 casp8_human Caspase-8 CASP8 MCH5 ICE-like apoptotic protease 5 MORT1-associated ced-3 homolog FADD-homologous ICE/ced-3-like protease FADD-like ICE Apoptotic cysteine protease Apoptotic protease Mch-5 CAP4 protein protein human Homo sapiens Human MDFSRNLYDIGEQLDSEDLASLKFLSLDYIPQRKQEPIKDALMLFQRLQEKRMLEESNLSFLKELLFRINRLDLLITYLNTRKEEMERELQTPGRAQISAYRVMLYQISEEVSRSELRSFKFLLQEEISKCKLDDDMNLLDIFIEMEKRVILGEGKLDILKRVCAQINKSLLKIINDYEEFSKERSSSLEGSPDEFSNGEELCGVMTISDSPREQDSESQTLDKVYQMKSKPRGYCLIINNHNFAKAREKVPKLHSIRDRNGTHLDAGALTTTFEELHFEIKPHDDCTVEQIYEILKIYQLMDHSNMDCFICCILSHGDKGIIYGTDGQEAPIYELTSQFTGLKCPSLAGKPKVFFIQACQGDNYQKGIPVETDSEEQPYLEMDLSSPQTRYIPDEADFLLGMATVNNCVSYRNPAEGTWYIQSLCQSLRERCPRGDDILTILTEVNYEVSNKDDKKNMGKQMPQPTFTLRKKLVFPSD DIP protein Q14790 original sequence version: 184 DIP protein Q14790 original sequence version: 135 DIP protein Q14790 original sequence version: 136 DIP protein Q14790 original sequence version: 147 DIP protein Q14790 original sequence version: 146 DIP protein Q14790 original sequence version: 170 DIP protein Q14790 original sequence version: 198 DIP protein Q14790-1 original sequence version: 197 DIP protein Q14790 original sequence version: 158 7A5FEAA6B39B582F mlp3b_human Microtubule-associated proteins 1A/1B light chain 3B MAP1LC3B MAP1ALC3 Microtubule-associated protein 1 light chain 3 beta MAP1A/MAP1B light chain 3 B MAP1 light chain 3-like protein 2 Autophagy-related protein LC3 B Autophagy-related ubiquitin-like modifier LC3 B protein protein human Homo sapiens Human MPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQETFGMKLSV DIP protein Q9GZQ8 original sequence version: 69 DIP protein Q9GZQ8 original sequence version: 108 DIP protein Q9GZQ8 original sequence version: 129 DIP protein Q9GZQ8 original sequence version: 132 DIP protein Q9GZQ8 original sequence version: 148 DIP protein Q9GZQ8 original sequence version: 152 DIP protein Q9GZQ8 original sequence version: 111 DIP protein Q9GZQ8 original sequence version: 153 BB141DEC7653E83F bax_human Apoptosis regulator BAX BAX BCL2L4 Bcl-2-like protein 4 protein protein human Homo sapiens Human MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQTVTIFVAGVLTASLTIWKKMG DIP protein Q07812 original sequence version: 73 DIP protein Q07812 original sequence version: 156 DIP protein Q07812 original sequence version: 92 DIP protein Q07812 original sequence version: 94 DIP protein Q07812-1 original sequence version: 93 DIP protein Q07812 original sequence version: 95 DIP protein Q07812 original sequence version: 120 DIP protein Q07812 original sequence version: 126 DIP protein Q07812 original sequence version: 143 DIP protein Q07812 original sequence version: 172 DIP protein Q07812 original sequence version: 175 6C0CDB0A7DEE4994 p25445-1 Tumor necrosis factor receptor superfamily member 6 FAS APT1 FAS1 TNFRSF6 Apo-1 antigen Apoptosis-mediating surface antigen FAS FASLG receptor protein protein human Homo sapiens Human MLGIWTLLPLVLTSVARLSSKSVNAQVTDINSKGLELRKTVTTVETQNLEGLHHDGQFCHKPCPPGERKARDCTVNGDEPDCVPCQEGKEYTDKAHFSSKCRRCRLCDEGHGLEVEINCTRTQNTKCRCKPNFFCNSTVCEHCDPCTKCEHGIIKECTLTSNTKCKEEGSRSNLGWLCLLLLPIPLIVWVKRKEVQKTCRKHRKENQGSHESPTLNPETVAINLSDVDLSKYITTIAGVMTLSQVKGFVRKNGVNEAKIDEIKNDNVQDTAEQKVQLLRNWHQLHGKKEAYDTLIKDLKKANLCTLAEKIQTIILKDITSDSENSNFRNEIQSLV DIP protein P25445-1 original sequence version: 126 DIP protein P25445 original sequence version: 149 DIP protein P25445-1 original sequence version: 145 DIP protein P25445 original sequence version: 153 DIP protein P25445-1 original sequence version: 153 DIP protein P25445 original sequence version: 152 DIP protein P25445-1 original sequence version: 204 DIP protein P25445 original sequence version: 176 map1lc3b-fas-1 7 14 unspecified role unspecified role prey prey human Homo sapiens Human 12 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association cav1-fas-1 4 14 unspecified role unspecified role prey prey P25445-1:p.Cys199Ser C199S mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain C S This feature has been corrected as a result of our quality control procedures. The original label was 'C199S'. Wed May 02 16:34:06 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys199ser' Tue Jun 30 18:10:06 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys199Ser' human Homo sapiens Human 10 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association cav1-map1lc3b-1 3 10 unspecified role unspecified role bait bait human Homo sapiens Human 12 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association Deletion of region 82-101 decreased the interaction rate/strength. fas-casp8-2 1 11 unspecified role unspecified role prey prey human Homo sapiens Human 14 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association map1lc3b-cav1-1 5 10 unspecified role unspecified role prey prey human Homo sapiens Human 12 unspecified role unspecified role bait bait Q9GZQ8:p.Tyr113Ala Y113A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Y A This feature has been corrected as a result of our quality control procedures. The original label was 'Y113A'. Wed May 02 16:45:41 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr113ala' Tue Jun 30 18:53:46 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr113Ala' human Homo sapiens Human physical association physical association cav1-fas-3 8 10 unspecified role unspecified role bait bait human Homo sapiens Human 14 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association bax-bid-1 2 9 unspecified role unspecified role prey prey human Homo sapiens Human 13 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association fas-cav1-1 6 10 unspecified role unspecified role prey prey human Homo sapiens Human 14 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association