DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Dimerization of a viral SET protein endows its function. Dimerization of a viral SET protein endows its function. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Wei H., Zhou MM. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Wei H., Zhou MM. DIP original experiment: DIP-220478X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Dimerization of a viral SET protein endows its function. Dimerization of a viral SET protein endows its function. Dimerization of a viral SET protein endows its function. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Wei H., Zhou MM. Only protein-protein interactions in vitro In vitro methyltransferase as methyltransferase assay methyltransferase as predetermined predetermined participant predetermined Wei H., Zhou MM. DIP original experiment: DIP-220473X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Dimerization of a viral SET protein endows its function. Dimerization of a viral SET protein endows its function. Dimerization of a viral SET protein endows its function. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Wei H., Zhou MM. Only protein-protein interactions ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Wei H., Zhou MM. DIP original experiment: DIP-220472X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Dimerization of a viral SET protein endows its function. Dimerization of a viral SET protein endows its function. Dimerization of a viral SET protein endows its function. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Wei H., Zhou MM. Only protein-protein interactions ecolx Escherichia coli pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Wei H., Zhou MM. DIP original experiment: DIP-220475X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Dimerization of a viral SET protein endows its function. Dimerization of a viral SET protein endows its function. Dimerization of a viral SET protein endows its function. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Wei H., Zhou MM. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Wei H., Zhou MM. DIP original experiment: DIP-220471X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Dimerization of a viral SET protein endows its function. Dimerization of a viral SET protein endows its function. Dimerization of a viral SET protein endows its function. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Wei H., Zhou MM. Only protein-protein interactions in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Wei H., Zhou MM. DIP original experiment: DIP-220474X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Dimerization of a viral SET protein endows its function. Dimerization of a viral SET protein endows its function. Dimerization of a viral SET protein endows its function. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Wei H., Zhou MM. Only protein-protein interactions in vitro In vitro fret fluorescent resonance energy transfer FRET RET FRET analysis FRET RET FRET analysis fret predetermined predetermined participant predetermined Wei H., Zhou MM. DIP original experiment: DIP-220477X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Dimerization of a viral SET protein endows its function. Dimerization of a viral SET protein endows its function. Dimerization of a viral SET protein endows its function. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Wei H., Zhou MM. Only protein-protein interactions ecolx Escherichia coli pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Wei H., Zhou MM. DIP original experiment: DIP-220476X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Dimerization of a viral SET protein endows its function. h3-6 Histone 3 peptide peptide peptide polypeptide oligopeptide oligopeptide polypeptide chemical synthesis Chemical synthesis (Chemical synthesis) GKAPRKQLATKAARKSAPATGGV o41094_pbcv1 A612L protein protein pbcv1 Paramecium bursaria Chlorella virus 1 (PBCV-1) MFNDRVIVKKSPLGGYGVFARKSFEKGELVEECLCIVRHNDDWGTALEDYLFSRKNMSAMALGFGAIFNHSKDPNARHELTAGLKRMRIFTIKPIAIGEEITISYGDDYWLSRPRLTQN DIP protein O41094 original sequence version: 56 9E57A5E72781E13E a612l-1 5 10 unspecified role unspecified role unspecified role unspecified role O41094:p.Met60Glu M60E/D mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain M E Wed May 02 19:00:27 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'met60glu' Tue Jun 30 18:48:40 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Met60Glu' O41094:p.Leu62Lys L62K mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L K This feature has been corrected as a result of our quality control procedures. The original label was 'L62K'. Wed May 02 18:06:46 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu62lys' Tue Jun 30 19:14:16 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu62Lys' O41094:p.Leu62Ala L62A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L A This feature has been corrected as a result of our quality control procedures. The original label was 'L62A'. Wed May 02 14:43:36 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu62ala' Tue Jun 30 16:21:20 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu62Ala' O41094:p.Ile36Ala I36A/K mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain I A Wed May 02 20:12:12 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile36ala' Tue Jun 30 15:39:46 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile36Ala' O41094:p.Met60Ala M60A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain M A This feature has been corrected as a result of our quality control procedures. The original label was 'M60A'. Wed May 02 17:37:46 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'met60ala' Tue Jun 30 18:04:21 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Met60Ala' O41094:p.Ile36Lys mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain I K Wed May 02 18:25:47 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile36lys' Tue Jun 30 17:59:38 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile36Lys' O41094:p.Met60Asp mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain M D Wed May 02 15:15:32 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'met60asp' Tue Jun 30 15:45:52 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Met60Asp' ecolx Escherichia coli direct interaction direct interaction a612l-a612l-1 4 10 unspecified role unspecified role prey prey StrepII-tag StrepII-tag strep ii tag strep ii tag Strep (II) Strep II Strep (II) Strep II c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecolx Escherichia coli 10 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli physical association physical association h3-a612l-1 7 9 unspecified role unspecified role fluorescence donor fluorescence donor Region 11-22 Region 11-22 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain CFP-tag CFP-tag cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal ecolx Escherichia coli 10 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept YFP-tag YFP-tag yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecolx Escherichia coli direct interaction direct interaction a612l-2 3 10 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction a612l-h3-1 6 9 unspecified role unspecified role unspecified role unspecified role Region 1-21 Region 1-21 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain in vitro In vitro 10 unspecified role unspecified role unspecified role unspecified role O41094:p.Met60Glu M60E mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain M E This feature has been corrected as a result of our quality control procedures. The original label was 'M60E'. Wed May 02 19:37:56 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'met60glu' Tue Jun 30 18:27:44 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Met60Glu' O41094:p.Leu62Lys L62K mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L K This feature has been corrected as a result of our quality control procedures. The original label was 'L62K'. Wed May 02 17:08:22 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu62lys' Tue Jun 30 19:17:24 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu62Lys' O41094:p.Tyr105Phe Y105F mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Y F This feature has been corrected as a result of our quality control procedures. The original label was 'Y105F'. Wed May 02 19:06:58 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr105phe' Tue Jun 30 17:56:34 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr105Phe' ecolx Escherichia coli direct interaction direct interaction a612l-a612l-2 8 10 unspecified role unspecified role bait bait StrepII-tag StrepII-tag strep ii tag strep ii tag Strep (II) Strep II Strep (II) Strep II c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecolx Escherichia coli 10 unspecified role unspecified role prey prey His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli direct interaction direct interaction a612l-h3-2 2 9 enzyme target enzyme target substrate substrate unspecified role unspecified role Region 1-21 Region 1-21 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain in vitro In vitro 10 enzyme enzyme unspecified role unspecified role O41094:p.Leu62Asp L62D mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L D This feature has been corrected as a result of our quality control procedures. The original label was 'L62D'. Wed May 02 18:28:05 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu62asp' Tue Jun 30 15:48:22 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu62Asp' O41094:p.Met60Asp M60E/D mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain M D Wed May 02 16:49:11 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'met60asp' Tue Jun 30 20:20:18 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Met60Asp' O41094:p.Ile36Ala I36A/K mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain I A Wed May 02 14:36:36 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile36ala' Tue Jun 30 20:12:55 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile36Ala' O41094:p.Leu62Ala L62A/K mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L A Wed May 02 16:52:22 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu62ala' Tue Jun 30 16:04:16 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu62Ala' O41094:p.Tyr105Phe Y105F mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Y F This feature has been corrected as a result of our quality control procedures. The original label was 'Y105F'. Wed May 02 15:41:55 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr105phe' Tue Jun 30 17:16:30 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr105Phe' O41094:p.Met60Glu mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain M E Wed May 02 18:02:12 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'met60glu' Tue Jun 30 20:18:14 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Met60Glu' O41094:p.Leu62Lys mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain L K Wed May 02 19:46:18 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu62lys' Tue Jun 30 18:12:01 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu62Lys' O41094:p.Ile36Lys mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain I K Wed May 02 16:40:08 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile36lys' Tue Jun 30 17:31:30 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile36Lys' ecolx Escherichia coli methylation methylation reaction methylation a612l-h3-3 1 9 unspecified role unspecified role unspecified role unspecified role Region 13-20 Region 13-20 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain in vitro In vitro 10 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction