DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Jasmonate perception by inositol-phosphate-potentiated COI1-JAZ co-receptor. Jasmonate perception by inositol-phosphate-potentiated COI1-JAZ co-receptor. Nature 2010 imex curation Sheard LB., Tan X., Mao H., Withers J., Ben-Nissan G., Hinds TR., Kobayashi Y., Hsu FF., Sharon M., Browse J., He SY., Rizo J., Howe GA., Zheng N. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Sheard LB., Tan X., Mao H., Withers J., Ben-Nissan G., Hinds TR., Kobayashi Y., Hsu FF., Sharon M., Browse J., He SY., Rizo J., Howe GA., Zheng N. DIP original experiment: DIP-219275X Nature 2010 IMEx Jasmonate perception by inositol-phosphate-potentiated COI1-JAZ co-receptor. Jasmonate perception by inositol-phosphate-potentiated COI1-JAZ co-receptor. Jasmonate perception by inositol-phosphate-potentiated COI1-JAZ co-receptor. Nature 2010 imex curation Sheard LB., Tan X., Mao H., Withers J., Ben-Nissan G., Hinds TR., Kobayashi Y., Hsu FF., Sharon M., Browse J., He SY., Rizo J., Howe GA., Zheng N. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Sheard LB., Tan X., Mao H., Withers J., Ben-Nissan G., Hinds TR., Kobayashi Y., Hsu FF., Sharon M., Browse J., He SY., Rizo J., Howe GA., Zheng N. DIP original experiment: DIP-219274X Nature 2010 IMEx Jasmonate perception by inositol-phosphate-potentiated COI1-JAZ co-receptor. Jasmonate perception by inositol-phosphate-potentiated COI1-JAZ co-receptor. Jasmonate perception by inositol-phosphate-potentiated COI1-JAZ co-receptor. Nature 2010 imex curation Sheard LB., Tan X., Mao H., Withers J., Ben-Nissan G., Hinds TR., Kobayashi Y., Hsu FF., Sharon M., Browse J., He SY., Rizo J., Howe GA., Zheng N. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Sheard LB., Tan X., Mao H., Withers J., Ben-Nissan G., Hinds TR., Kobayashi Y., Hsu FF., Sharon M., Browse J., He SY., Rizo J., Howe GA., Zheng N. DIP original experiment: DIP-219277X Nature 2010 IMEx Jasmonate perception by inositol-phosphate-potentiated COI1-JAZ co-receptor. Jasmonate perception by inositol-phosphate-potentiated COI1-JAZ co-receptor. Jasmonate perception by inositol-phosphate-potentiated COI1-JAZ co-receptor. Nature 2010 imex curation Sheard LB., Tan X., Mao H., Withers J., Ben-Nissan G., Hinds TR., Kobayashi Y., Hsu FF., Sharon M., Browse J., He SY., Rizo J., Howe GA., Zheng N. Only protein-protein interactions trini Trichoplusia ni (Cabbage looper) Cabbage looper ms of complexes mass spectrometry studies of complexes ms of complexes predetermined predetermined participant predetermined Sheard LB., Tan X., Mao H., Withers J., Ben-Nissan G., Hinds TR., Kobayashi Y., Hsu FF., Sharon M., Browse J., He SY., Rizo J., Howe GA., Zheng N. DIP original experiment: DIP-219276X Nature 2010 IMEx Jasmonate perception by inositol-phosphate-potentiated COI1-JAZ co-receptor. Jasmonate perception by inositol-phosphate-potentiated COI1-JAZ co-receptor. Jasmonate perception by inositol-phosphate-potentiated COI1-JAZ co-receptor. Nature 2010 imex curation Sheard LB., Tan X., Mao H., Withers J., Ben-Nissan G., Hinds TR., Kobayashi Y., Hsu FF., Sharon M., Browse J., He SY., Rizo J., Howe GA., Zheng N. Only protein-protein interactions trini Trichoplusia ni (Cabbage looper) Cabbage looper pull down pull down predetermined predetermined participant predetermined Sheard LB., Tan X., Mao H., Withers J., Ben-Nissan G., Hinds TR., Kobayashi Y., Hsu FF., Sharon M., Browse J., He SY., Rizo J., Howe GA., Zheng N. DIP original experiment: DIP-219273X Nature 2010 IMEx Jasmonate perception by inositol-phosphate-potentiated COI1-JAZ co-receptor. Jasmonate perception by inositol-phosphate-potentiated COI1-JAZ co-receptor. Jasmonate perception by inositol-phosphate-potentiated COI1-JAZ co-receptor. Nature 2010 imex curation Sheard LB., Tan X., Mao H., Withers J., Ben-Nissan G., Hinds TR., Kobayashi Y., Hsu FF., Sharon M., Browse J., He SY., Rizo J., Howe GA., Zheng N. Only protein-protein interactions trini Trichoplusia ni (Cabbage looper) Cabbage looper molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Sheard LB., Tan X., Mao H., Withers J., Ben-Nissan G., Hinds TR., Kobayashi Y., Hsu FF., Sharon M., Browse J., He SY., Rizo J., Howe GA., Zheng N. DIP original experiment: DIP-219272X Nature 2010 IMEx Jasmonate perception by inositol-phosphate-potentiated COI1-JAZ co-receptor. ti10a_arath Protein TIFY 10A TIFY10A JAZ1 At1g19180 T29M8.5 Jasmonate ZIM domain-containing protein 1 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSSSMECSEFVGSRRFTGKKPSFSQTCSRLSQYLKENGSFGDLSLGMACKPDVNGTLGNSRQPTTTMSLFPCEASNMDSMVQDVKPTNLFPRQPSFSSSSSSLPKEDVLKMTQTTRSVKPESQTAPLTIFYAGQVIVFNDFSAEKAKEVINLASKGTANSLAKNQTDIRSNIATIANQVPHPRKTTTQEPIQSSPTPLTELPIARRASLHRFLEKRKDRVTSKAPYQLCDPAKASSNPQTTGNMSWLGLAAEI DIP protein Q9LMA8 original sequence version: 76 DIP protein Q9LMA8 original sequence version: 72 DIP protein Q9LMA8 original sequence version: 51 DIP protein Q9LMA8 original sequence version: 57 DIP protein Q9LMA8 original sequence version: 74 DIP protein Q9LMA8 original sequence version: 81 DIP protein Q9LMA8 original sequence version: 92 EF2DAAC0CEF2DBBB coi1_arath Coronatine-insensitive protein 1 FBL2 At2g39940 COI1 COI-1 F-box/LRR-repeat protein 2 T28M21.10 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEDPDIKRCKLSCVATVDDVIEQVMTYITDPKDRDSASLVCRRWFKIDSETREHVTMALCYTATPDRLSRRFPNLRSLKLKGKPRAAMFNLIPENWGGYVTPWVTEISNNLRQLKSVHFRRMIVSDLDLDRLAKARADDLETLKLDKCSGFTTDGLLSIVTHCRKIKTLLMEESSFSEKDGKWLHELAQHNTSLEVLNFYMTEFAKISPKDLETIARNCRSLVSVKVGDFEILELVGFFKAAANLEEFCGGSLNEDIGMPEKYMNLVFPRKLCRLGLSYMGPNEMPILFPFAAQIRKLDLLYALLETEDHCTLIQKCPNLEVLETRNVIGDRGLEVLAQYCKQLKRLRIERGADEQGMEDEEGLVSQRGLIALAQGCQELEYMAVYVSDITNESLESIGTYLKNLCDFRLVLLDREERITDLPLDNGVRSLLIGCKKLRRFAFYLRQGGLTDLGLSYIGQYSPNVRWMLLGYVGESDEGLMEFSRGCPNLQKLEMRGCCFSERAIAAAVTKLPSLRYLWVQGYRASMTGQDLMQMARPYWNIELIPSRRVPEVNQQGEIREMEHPAHILAYYSLAGQRTDCPTTVRVLKEPI DIP protein O04197 original sequence version: 103 DIP protein O04197 original sequence version: 98 DIP protein O04197 original sequence version: 80 DIP protein O04197 original sequence version: 84 DIP protein O04197 original sequence version: 101 DIP protein O04197 original sequence version: 119 1DDCF04990144C06 skp1a_arath SKP1-like protein 1A UFO-binding protein 1 SKP1 UIP1 At1g75950 T4O12.17 SKP1A ASK1 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSAKKIVLKSSDGESFEVEEAVALESQTIAHMVEDDCVDNGVPLPNVTSKILAKVIEYCKRHVEAAASKAEAVEGAATSDDDLKAWDADFMKIDQATLFELILAANYLNIKNLLDLTCQTVADMIKGKTPEEIRTTFNIKNDFTPEEEEEVRRENQWAFE DIP protein Q39255 original sequence version: 115 DIP protein Q39255 original sequence version: 118 DIP protein Q39255 original sequence version: 108 DIP protein Q39255 original sequence version: 88 DIP protein Q39255 original sequence version: 100 56B84C19FD5ABF17 coi1-skp1a-1 6 8 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper 9 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction coi1-skp1a-2 4 8 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper 9 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction coi1-tify10a-3 3 7 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 8 unspecified role unspecified role bait bait O04197:p.Met88Ala M88A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain M A This feature has been corrected as a result of our quality control procedures. The original label was 'M88A'. Wed May 02 16:37:31 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'met88ala' Tue Jun 30 19:26:35 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Met88Ala' O04197:p.Arg121Ala R121A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain R A This feature has been corrected as a result of our quality control procedures. The original label was 'R121A'. Wed May 02 18:53:08 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg121ala' Tue Jun 30 16:40:09 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg121Ala' O04197:p.Arg85Ala R85A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain R A This feature has been corrected as a result of our quality control procedures. The original label was 'R85A'. Wed May 02 15:27:33 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg85ala' Tue Jun 30 16:58:32 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg85Ala' O04197:p.Phe89Ala F89A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain F A This feature has been corrected as a result of our quality control procedures. The original label was 'F89A'. Wed May 02 19:10:12 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe89ala' Tue Jun 30 17:42:54 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe89Ala' O04197:p.Arg348Ala R348A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain R A This feature has been corrected as a result of our quality control procedures. The original label was 'R348A'. Wed May 02 17:07:08 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg348ala' Tue Jun 30 17:24:36 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg348Ala' O04197:p.Tyr386Ala Y386A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Y A This feature has been corrected as a result of our quality control procedures. The original label was 'Y386A'. Wed May 02 19:18:16 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr386ala' Tue Jun 30 20:16:07 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr386Ala' O04197:p.Arg409Ala R409A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain R A This feature has been corrected as a result of our quality control procedures. The original label was 'R409A'. Wed May 02 18:47:14 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg409ala' Tue Jun 30 15:43:26 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg409Ala' O04197:p.Tyr444Ala Y444A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Y A This feature has been corrected as a result of our quality control procedures. The original label was 'Y444A'. Wed May 02 20:16:02 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr444ala' Tue Jun 30 20:14:27 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr444Ala' O04197:p.Leu469Ala L469A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L A This feature has been corrected as a result of our quality control procedures. The original label was 'L469A'. Wed May 02 19:17:19 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu469ala' Tue Jun 30 17:05:59 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu469Ala' O04197:p.Arg496Ala R496A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain R A This feature has been corrected as a result of our quality control procedures. The original label was 'R496A'. Wed May 02 15:07:29 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg496ala' Tue Jun 30 19:25:13 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg496Ala' O04197:p.Leu301Ala L301A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L A This feature has been corrected as a result of our quality control procedures. The original label was 'L301A'. Wed May 02 18:13:17 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu301ala' Tue Jun 30 20:05:06 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu301Ala' O04197:p.Tyr302Ala Y302A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Y A This feature has been corrected as a result of our quality control procedures. The original label was 'Y302A'. Wed May 02 15:09:09 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr302ala' Tue Jun 30 18:31:42 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr302Ala' O04197:p.Arg326Ala R326A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain R A This feature has been corrected as a result of our quality control procedures. The original label was 'R326A'. Wed May 02 15:26:13 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg326ala' Tue Jun 30 18:16:15 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg326Ala' O04197:p.Arg351Ala R351A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain R A This feature has been corrected as a result of our quality control procedures. The original label was 'R351A'. Wed May 02 20:06:32 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg351ala' Tue Jun 30 16:20:07 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg351Ala' yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction coi1-skp1a-3 5 8 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range trini Trichoplusia ni (Cabbage looper) Cabbage looper 9 unspecified role unspecified role prey prey trini Trichoplusia ni (Cabbage looper) Cabbage looper physical association physical association coi1-skp1a-4 1 7 unspecified role unspecified role unspecified role unspecified role Region 200-220 Region 200-220 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Region 205-226 Region 205-226 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain in vitro In vitro 8 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper 9 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper physical association physical association tify10a-coi1-1 2 7 unspecified role unspecified role bait bait Region 200-220 Region 200-220 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecolx Escherichia coli 8 unspecified role unspecified role prey prey trini Trichoplusia ni (Cabbage looper) Cabbage looper physical association physical association