DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Structure of the Dom34-Hbs1 complex and implications for no-go decay. Structure of the Dom34-Hbs1 complex and implications for no-go decay. Nature structural & molecular biology 2010 imex curation Chen L., Muhlrad D., Hauryliuk V., Cheng Z., Lim MK., Shyp V., Parker R., Song H. Only protein-protein interactions in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Chen L., Muhlrad D., Hauryliuk V., Cheng Z., Lim MK., Shyp V., Parker R., Song H. DIP original experiment: DIP-217668X Nature structural & molecular biology 2010 IMEx Structure of the Dom34-Hbs1 complex and implications for no-go decay. Structure of the Dom34-Hbs1 complex and implications for no-go decay. Structure of the Dom34-Hbs1 complex and implications for no-go decay. Nature structural & molecular biology 2010 imex curation Chen L., Muhlrad D., Hauryliuk V., Cheng Z., Lim MK., Shyp V., Parker R., Song H. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Chen L., Muhlrad D., Hauryliuk V., Cheng Z., Lim MK., Shyp V., Parker R., Song H. DIP original experiment: DIP-217664X Nature structural & molecular biology 2010 IMEx Structure of the Dom34-Hbs1 complex and implications for no-go decay. Structure of the Dom34-Hbs1 complex and implications for no-go decay. Structure of the Dom34-Hbs1 complex and implications for no-go decay. Nature structural & molecular biology 2010 imex curation Chen L., Muhlrad D., Hauryliuk V., Cheng Z., Lim MK., Shyp V., Parker R., Song H. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Chen L., Muhlrad D., Hauryliuk V., Cheng Z., Lim MK., Shyp V., Parker R., Song H. DIP original experiment: DIP-217666X Nature structural & molecular biology 2010 IMEx Structure of the Dom34-Hbs1 complex and implications for no-go decay. Structure of the Dom34-Hbs1 complex and implications for no-go decay. Structure of the Dom34-Hbs1 complex and implications for no-go decay. Nature structural & molecular biology 2010 imex curation Chen L., Muhlrad D., Hauryliuk V., Cheng Z., Lim MK., Shyp V., Parker R., Song H. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Chen L., Muhlrad D., Hauryliuk V., Cheng Z., Lim MK., Shyp V., Parker R., Song H. DIP original experiment: DIP-217665X Nature structural & molecular biology 2010 IMEx Structure of the Dom34-Hbs1 complex and implications for no-go decay. Structure of the Dom34-Hbs1 complex and implications for no-go decay. Structure of the Dom34-Hbs1 complex and implications for no-go decay. Nature structural & molecular biology 2010 imex curation Chen L., Muhlrad D., Hauryliuk V., Cheng Z., Lim MK., Shyp V., Parker R., Song H. Only protein-protein interactions in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Chen L., Muhlrad D., Hauryliuk V., Cheng Z., Lim MK., Shyp V., Parker R., Song H. DIP original experiment: DIP-217667X Nature structural & molecular biology 2010 IMEx Structure of the Dom34-Hbs1 complex and implications for no-go decay. hbs1_schpo Elongation factor 1 alpha-like protein hbs1 SPBC25B2.01 SPBC2G5.08 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MSRHRDVKNLDLDDYELDEEPGEEELTEEQEEEFRSAVATVRETLLGVPISEKEIADTVWYYYFDVEKSVNYLLQKASSKAGAKEKQNTDSQKEKKQNKSKEALADAKDPLDESSNGIKNLSLNKNDEPAFQTNGEVKMKNSSESDNQPEKKKIKKQNPTDLVSVPEIFEQSNPKPVVHLVVTGHVDSGKSTMLGRIMFELGEINSRSMQKLHNEAANSGKGSFSYAWLLDTTEEERARGVTMDVASTTFESDKKIYEIGDAPGHRDFISGMIAGASSADFAVLVVDSSQNNFERGFLENGQTREHAYLLRALGISEIVVSVNKLDLMSWSEDRFQEIKNIVSDFLIKMVGFKTSNVHFVPISAISGTNLIQKDSSDLYKWYKGPTLLSALDQLVPPEKPYRKPLRLSIDDVYRSPRSVTVTGRVEAGNVQVNQVLYDVSSQEDAYVKNVIRNSDPSSTWAVAGDTVTLQLADIEVNQLRPGDILSNYENPVRRVRSFVAEIQTFDIHGPILSGSTLVLHLGRTVTSVSLKIVTVNNKRSRHIASRKRALVRISFLDGLFPLCLAEECPALGRFILRRSGDTVAAGIVKELC 44BE2B324C97B455 dom34_schpo Protein dom34 dom34 SPCC18B5.06 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MKLIQKNIEKNGSGWITMCPEEPEDMWHLYNILQVGDQLKASTVRRVVKVGATGSTSGSRVVMKLRILVENMDFDTKAAQLHIKGRTTEYHPEVKMGSYHTLDLELHRNFTLYKNEWDAFALDRVDAACNPSRNAEIGAVVLDEGLANICLITDYMTILRQRIDQVIPRKRRGDSSAYQKGLDKFYDSVFQSINSEFDFDKLKVVILASPGFVARGLYDYIFSMAVKLDLKQIVKSKNKFVILHSSTGHIHSLNEILKDPAVESKLADTKYVQEIRVLNKFYDVMNEDDRKAWYGPNHVLKAFELGAIGELLISDSLFRSSDIATRKKWVSLVEGVKEINCPVYIFSSLHESGKQLDLLSGIAAILTYPVDEEDISEDEEDEESQNFEHS 225978CC3D8F8E64 hbs1-dom34-2 2 7 unspecified role unspecified role prey prey ecolx Escherichia coli 6 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli direct interaction direct interaction dom34-hbs1-1 5 7 unspecified role unspecified role unspecified role unspecified role Q9USL5:p.Arg162Ala R162A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain R A This feature has been corrected as a result of our quality control procedures. The original label was 'R162A'. Wed May 02 19:46:38 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg162ala' Tue Jun 30 17:50:56 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg162Ala' Q9USL5:p.Asp164Ala D164A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain D A This feature has been corrected as a result of our quality control procedures. The original label was 'D164A'. Wed May 02 15:33:39 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp164ala' Tue Jun 30 19:28:33 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp164Ala' ecolx Escherichia coli 6 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction dom34-hbs1-2 4 7 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 6 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction dom34-hbs1-3 1 7 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 6 unspecified role unspecified role unspecified role unspecified role O74774:p.Asp411Ala D411A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain D A This feature has been corrected as a result of our quality control procedures. The original label was 'D411A'. Wed May 02 20:31:53 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp411ala' Tue Jun 30 15:35:36 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp411Ala' O74774:p.Arg480Ala R480A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain R A This feature has been corrected as a result of our quality control procedures. The original label was 'R480A'. Wed May 02 17:32:54 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg480ala' Tue Jun 30 17:37:43 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg480Ala' O74774:p.Arg523Ala R523A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain R A This feature has been corrected as a result of our quality control procedures. The original label was 'R523A'. Wed May 02 20:27:46 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg523ala' Tue Jun 30 16:01:21 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg523Ala' O74774:p.Lys531Ala K531A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain K A This feature has been corrected as a result of our quality control procedures. The original label was 'K531A'. Wed May 02 17:27:34 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys531ala' Tue Jun 30 16:38:16 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys531Ala' O74774:p.Arg541Ala R541A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain R A This feature has been corrected as a result of our quality control procedures. The original label was 'R541A'. Wed May 02 14:38:14 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg541ala' Tue Jun 30 19:31:37 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg541Ala' O74774:p.Asp557Ala D557A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain D A This feature has been corrected as a result of our quality control procedures. The original label was 'D557A'. Wed May 02 20:20:26 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp557ala' Tue Jun 30 18:50:16 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp557Ala' ecolx Escherichia coli direct interaction direct interaction dom34-hbs1-4 3 7 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 6 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction