DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu FERONIA receptor-like kinase regulates RHO GTPase signaling of root hair development. FERONIA receptor-like kinase regulates RHO GTPase signaling of root hair development. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Duan Q., Kita D., Li C., Cheung AY., Wu HM. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Duan Q., Kita D., Li C., Cheung AY., Wu HM. DIP original experiment: DIP-220030X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx FERONIA receptor-like kinase regulates RHO GTPase signaling of root hair development. FERONIA receptor-like kinase regulates RHO GTPase signaling of root hair development. FERONIA receptor-like kinase regulates RHO GTPase signaling of root hair development. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Duan Q., Kita D., Li C., Cheung AY., Wu HM. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Duan Q., Kita D., Li C., Cheung AY., Wu HM. DIP original experiment: DIP-220029X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx FERONIA receptor-like kinase regulates RHO GTPase signaling of root hair development. FERONIA receptor-like kinase regulates RHO GTPase signaling of root hair development. FERONIA receptor-like kinase regulates RHO GTPase signaling of root hair development. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Duan Q., Kita D., Li C., Cheung AY., Wu HM. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Duan Q., Kita D., Li C., Cheung AY., Wu HM. DIP original experiment: DIP-220025X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx FERONIA receptor-like kinase regulates RHO GTPase signaling of root hair development. FERONIA receptor-like kinase regulates RHO GTPase signaling of root hair development. FERONIA receptor-like kinase regulates RHO GTPase signaling of root hair development. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Duan Q., Kita D., Li C., Cheung AY., Wu HM. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Duan Q., Kita D., Li C., Cheung AY., Wu HM. DIP original experiment: DIP-220031X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx FERONIA receptor-like kinase regulates RHO GTPase signaling of root hair development. FERONIA receptor-like kinase regulates RHO GTPase signaling of root hair development. FERONIA receptor-like kinase regulates RHO GTPase signaling of root hair development. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Duan Q., Kita D., Li C., Cheung AY., Wu HM. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Duan Q., Kita D., Li C., Cheung AY., Wu HM. DIP original experiment: DIP-220034X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx FERONIA receptor-like kinase regulates RHO GTPase signaling of root hair development. FERONIA receptor-like kinase regulates RHO GTPase signaling of root hair development. FERONIA receptor-like kinase regulates RHO GTPase signaling of root hair development. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Duan Q., Kita D., Li C., Cheung AY., Wu HM. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Duan Q., Kita D., Li C., Cheung AY., Wu HM. DIP original experiment: DIP-220032X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx FERONIA receptor-like kinase regulates RHO GTPase signaling of root hair development. FERONIA receptor-like kinase regulates RHO GTPase signaling of root hair development. FERONIA receptor-like kinase regulates RHO GTPase signaling of root hair development. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Duan Q., Kita D., Li C., Cheung AY., Wu HM. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Duan Q., Kita D., Li C., Cheung AY., Wu HM. DIP original experiment: DIP-220028X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx FERONIA receptor-like kinase regulates RHO GTPase signaling of root hair development. FERONIA receptor-like kinase regulates RHO GTPase signaling of root hair development. FERONIA receptor-like kinase regulates RHO GTPase signaling of root hair development. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Duan Q., Kita D., Li C., Cheung AY., Wu HM. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Duan Q., Kita D., Li C., Cheung AY., Wu HM. DIP original experiment: DIP-220033X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx FERONIA receptor-like kinase regulates RHO GTPase signaling of root hair development. FERONIA receptor-like kinase regulates RHO GTPase signaling of root hair development. FERONIA receptor-like kinase regulates RHO GTPase signaling of root hair development. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Duan Q., Kita D., Li C., Cheung AY., Wu HM. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Duan Q., Kita D., Li C., Cheung AY., Wu HM. DIP original experiment: DIP-220024X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx FERONIA receptor-like kinase regulates RHO GTPase signaling of root hair development. FERONIA receptor-like kinase regulates RHO GTPase signaling of root hair development. FERONIA receptor-like kinase regulates RHO GTPase signaling of root hair development. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Duan Q., Kita D., Li C., Cheung AY., Wu HM. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Duan Q., Kita D., Li C., Cheung AY., Wu HM. DIP original experiment: DIP-220026X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx FERONIA receptor-like kinase regulates RHO GTPase signaling of root hair development. FERONIA receptor-like kinase regulates RHO GTPase signaling of root hair development. FERONIA receptor-like kinase regulates RHO GTPase signaling of root hair development. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Duan Q., Kita D., Li C., Cheung AY., Wu HM. Only protein-protein interactions arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Duan Q., Kita D., Li C., Cheung AY., Wu HM. DIP original experiment: DIP-220027X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx FERONIA receptor-like kinase regulates RHO GTPase signaling of root hair development. rogfe_arath Rop guanine nucleotide exchange factor 14 ROPGEF14 Rho of plants guanine nucleotide exchange factor 14 F27M3.15 At1g31650 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MMLMRRRLACCSREREISIDFDEHEQDKMITYYGLETCIINNQSYEEESGTSRGDGCLTDSLDDDAFSSCSSSKDASSSFSSKWLPMKNDEHSCDGLNLSGRSQHFDAKEKKKQGYGSSQHFDAKEKPGYVYCHLDVEAMKEKFSKLLLGEDVTGGCKGVQVALALSNAVTHLATSIFGELWKLEPLCEEKKQKWRREMDWLLSPTNYMIELVPSKQNDANGRSLEIMTPKARADIHMNLPALQKLDSMLIETLDSMVNTEFWYSEIGSRAEGKNKSTSESKRWWLPSPQVPKPGLSNSGRKKLLDKGKVVYQVFKATKAINENILLEMPVPIVIKEAIPKSGKNSLGDELYKMLAVESATVDEIFISLNLGTEHAALETVNKLESAMFAWKERITEQGSNGKSPVRASWSFAKDPLSEIGRNESLLNRAEALRTQIKSKHPNLPHSFLDATKIQYDKDIGHAVLEAYSRTLANLAFRILSRMGEILKEDSLSNPNSPAPPSCFPSSRDPYRTPERPLLSSRVRHSLTDDMNKADGTETGLDFLFADAKASNSVNTTPSRSSRLWCLSKVPSDTSP DIP protein Q56WM6 original sequence version: 33 rogfa_arath Rop guanine nucleotide exchange factor 10 ROPGEF10 Rho of plants guanine nucleotide exchange factor 10 At5g19560 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MFDGRNSGHSSFSSRGDGMHTPEHELAGHAAPSTRRGKQNRRSDMEVMKERFAKLLLGEDMSGGGTGETSALALSNAITKLADSMFGEQMKLQPMYPETKENWRKEMGWLLSVIDHIVQFVPSRQMGKNGQFTEIMVTKQRDDLLTNIPALRKLDSVLLETLDNFKDQKDFWYVPRDMEDADHNGDWRRDENWWLPVVKVPTDGLSEESRRWLQNQKDSVAQVLKAATAINAHVLSEMHVPENYIDSLPKNGKTSLGDFLYKSITEESFDPDYFVSFLDLSTEHKVLDLKNRIEASMVIWKRKMCQKEKDGKSQWGSTVSLEKRELFEVRAETILVMLKQQFPGIPQSSLEVSKIKNNKDVGQAILESYSRVLESLASKIMSRIEDVLEADRLVQRQLMGEAETRSESEAESEYEETEKVVAAETPNSRKLSDFIGWRLSSDTKKHSSMSDIEFFHKVEQEKEKPMMKSPRALPKKFSYLAKLENMRSPSDRH DIP protein Q1KS66 original sequence version: 1 DIP protein Q1KS66 original sequence version: 18 rogf4_arath Rop guanine nucleotide exchange factor 4 ROPGEF4 Rho of plants guanine nucleotide exchange factor 4 F4I18.13 At2g45890 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MESSSNSDQNEGTPTSSVSSPYRRTYSDISGLSHRFDVQSFYNRPSNTNAVVLSGHEEDVSEDAEEPKDDVVNDVHGDGDEEDSDIDSAEDAELEMMRERFAKLLLGEDMSGSGKGVCTAVTVSNSITNLYATVFGQSLRLQPLSTEKKDLWKREMNCFMSICDYIVEVIPRSLGTNVEITETKLRSDILMSLPALRKLDNMLMEILDSFTENEFWYVERGSSSMNSGGGGRDSGTFRKVVVQRKDEKWWLPVPCVPAEGLSEEERKHLRHKRDCASQIHKAALAINDSTLNDMDIPDSYLTTLPKSGKASVGDVIYKQLCTAEKFYPDQLLDILKITSEHEALELADKVEASLVTWRRKTGGLTHSKSSWDMMKDISGDADRGNDKNHILAARARSLLFCLKQRYPELSQTSLDICKIQFNRDVGKAVLESYSRVLEGLAYNVVSWIDDVLYVDRTVRNRDD DIP protein Q0WNP7 original sequence version: 33 DIP protein Q0WNP7 original sequence version: 50 mint 41C2DA9959AA74C1 rogf7_arath Rop guanine nucleotide exchange factor 7 ROPGEF7 Rho of plants guanine nucleotide exchange factor 7 T7H20.60 At5g02010 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDGSSENLPEVEEKGRESSCCSSETTRQEEEEQSPSCTEDFTASPVSSRWSVKNIDGEKKKIRSDSRVSEVEMMKERFSKLLLGEDMSGSGNGVCTALAISNAITNLCATLFGQLWRLEPLPTEKKEMWRREMEWLLCVSDHIVEMTPTWQTFPDGTKLEIMTCRPRSDLYVNLPALRKLDNMLLEILDSFEETEFWYVDQGIMAHESAADGSSSFRKSFQRQEDKWWLPVPRVSPGGLQENSRKQLQHKRDCTNQILKAAMAINSITLADMEIPESYLESLPRKGRSCLGDLIYRYISSDQFSPECLLDCLDLSSEHQAIEIANRVESSIYLWHKRTNSKPATNTKTSWEMVKELMVDADKLELMADRAESLLLSLKQRFPGLPQTALDMSKIQYNKDIGKSILESYSRVLESLAFNIVARIDDLLFVDDLTRHSSDQIPTTLGNNGNDAPKSIAVPVSNYTTPSYSPSKQELRSSITVPPSPSRFKIPHSSSVKRVLTAYVTKNEPRLKNLPLERSSRSSSSERLSLEKCMKESLNVSNLDPGI DIP protein Q9LZN0 original sequence version: 48 rac4_arath Rac-like GTP-binding protein ARAC4 ARAC4 ROP2 T20H2.12 At1g20090 GTPase protein ROP2 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGNTVNLGLWDTAGQEDYNRLRPLSYRGADVFILAFSLISKASYENIAKKWIPELRHYAPGVPIILVGTKLDLRDDKQFFIDHPGAVPITTNQGEELKKLIGSAVYIECSSKTQQNVKAVFDAAIKVVLQPPKQKKKKKNKNRCAFL DIP protein Q38919 original sequence version: 65 DIP protein Q38919 original sequence version: 88 90899399AB7EA658 rogf1_arath Rop guanine nucleotide exchange factor 1 ROPGEF1 Rho of plants guanine nucleotide exchange factor 1 Kinase partner protein-like F22I13.200 At4g38430 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MGSLSSEEDDEVSSERCGSYSPSADISESESSSSFSCHRFDGEGASSSIPSSPRVVAGRGFYFPAPVMLPVIGGKDVVWDDKQPDNDLSEIEMMKERFAKLLLGEDMSGGGKGVCTALAISNAITNLSATVFGELWRLEPLAPQKKAMWRRELEWLLCVSDSIVELIPSIQQFPGGGTYEIMETRPRSDLYANLPALKKLDAMLIDMLDAFSDTEFWYTDRGIVLGDCDKDSYNSPASVRQEDKWWLPCPKVPPNGLSEEARKKLQQCRDFANQILKAALAINSGVLAEMEIPDPYLETLPKSGKECLGEIIYQYLTANKFSPECLLDCLDLSSEHQTLEIANRIEAAVHVWRQKNGRRHKKQAKLKLSSWGGKVKGLVNDNERNDFLVQRAETLLQSLRIRFPGLPQTTLDMNKIQYNKDVGQSILESYSRVMESMAFNITARIDDVLYVDDAMRRSISVTESLSLFSINGLNPQKAFSVQSSPHGSPFATPALSVASRSPRRAPPLYSVKRNGTREKGIVGETEKAWSYAGNLSSRRVTGVTPERD DIP protein Q93ZY2 original sequence version: 48 DIP protein Q93ZY2 original sequence version: 80 DIP protein Q93ZY2 original sequence version: 60 7E6A8086E0FA5EC6 feron_arath Receptor-like protein kinase FERONIA FER AAK1 SIR SRN F26O13.190 At3g51550 Protein SIRENE protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MKITEGRFRLSLLLLLLLISAATLISAADYSPTEKILLNCGGGASNLTDTDNRIWISDVKSKFLSSSSEDSKTSPALTQDPSVPEVPYMTARVFRSPFTYTFPVASGRKFVRLYFYPNSYDGLNATNSLFSVSFGPYTLLKNFSASQTAEALTYAFIIKEFVVNVEGGTLNMTFTPESAPSNAYAFVNGIEVTSMPDMYSSTDGTLTMVGSSGSVTIDNSTALENVYRLNVGGNDISPSADTGLYRSWYDDQPYIFGAGLGIPETADPNMTIKYPTGTPTYVAPVDVYSTARSMGPTAQINLNYNLTWIFSIDSGFTYLVRLHFCEVSSNITKINQRVFTIYLNNQTAEPEADVIAWTSSNGVPFHKDYVVNPPEGNGQQDLWLALHPNPVNKPEYYDSLLNGVEIFKMNTSDGNLAGTNPIPGPQVTADPSKVLRPTTRKSKSNTAIIAGAASGAVVLALIIGFCVFGAYRRRKRGDYQPASDATSGWLPLSLYGNSHSAGSAKTNTTGSYASSLPSNLCRHFSFAEIKAATKNFDESRVLGVGGFGKVYRGEIDGGTTKVAIKRGNPMSEQGVHEFQTEIEMLSKLRHRHLVSLIGYCEENCEMILVYDYMAHGTMREHLYKTQNPSLPWKQRLEICIGAARGLHYLHTGAKHTIIHRDVKTTNILLDEKWVAKVSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEALCARPALNPTLAKEQVSLAEWAPYCYKKGMLDQIVDPYLKGKITPECFKKFAETAMKCVLDQGIERPSMGDVLWNLEFALQLQESAEENGKGVCGDMDMDEIKYDDGNCKGKNDKSSDVYEGNVTDSRSSGIDMSIGGRSLASEDSDGLTPSAVFSQIMNPKGR DIP protein Q9SCZ4 original sequence version: 84 DIP protein Q9SCZ4 original sequence version: 115 ropgef1-fer-1 9 18 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 17 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction fer-ropgef14-1 4 12 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 18 unspecified role unspecified role bait bait Kinase domain Region 536-810 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction fer-ropgef1-1 11 18 unspecified role unspecified role unspecified role unspecified role C-terminal domain of YFP YFP-tag yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress 17 unspecified role unspecified role unspecified role unspecified role N-terminal domain of YFP YFP-tag yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress physical association physical association arac4-fer-1 8 16 unspecified role unspecified role bait bait MBP-tag MBP-tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecolx Escherichia coli 18 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress physical association physical association fer-ropgef7-1 2 15 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 18 unspecified role unspecified role bait bait Kinase domain Region 536-810 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction ropgef1-fer-2 3 18 unspecified role unspecified role prey prey Kinase domain Region 536-810 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 17 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction fer-ropgef10-1 1 13 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 18 unspecified role unspecified role bait bait Kinase domain Region 536-810 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction arac4-fer-2 6 16 unspecified role unspecified role bait bait MBP-tag MBP-tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecolx Escherichia coli 18 unspecified role unspecified role prey prey GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress physical association physical association fer-ropgef4-1 7 14 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 18 unspecified role unspecified role bait bait Kinase domain Region 536-810 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction arac4-ropgef4-1 5 14 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress 16 unspecified role unspecified role bait bait MBP-tag MBP-tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecolx Escherichia coli physical association physical association fer-ropgef1-2 10 18 unspecified role unspecified role bait bait Kinase domain Region 536-810 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 17 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction