DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Lateral opening of a translocon upon entry of protein suggests the mechanism of insertion into membranes. Lateral opening of a translocon upon entry of protein suggests the mechanism of insertion into membranes. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Egea PF., Stroud RM. Only protein-protein interactions ecolx Escherichia coli pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Egea PF., Stroud RM. DIP original experiment: DIP-220020X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Lateral opening of a translocon upon entry of protein suggests the mechanism of insertion into membranes. Lateral opening of a translocon upon entry of protein suggests the mechanism of insertion into membranes. Lateral opening of a translocon upon entry of protein suggests the mechanism of insertion into membranes. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Egea PF., Stroud RM. Only protein-protein interactions ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Egea PF., Stroud RM. DIP original experiment: DIP-220015X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Lateral opening of a translocon upon entry of protein suggests the mechanism of insertion into membranes. Lateral opening of a translocon upon entry of protein suggests the mechanism of insertion into membranes. Lateral opening of a translocon upon entry of protein suggests the mechanism of insertion into membranes. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Egea PF., Stroud RM. Only protein-protein interactions ecolx Escherichia coli pull down pull down predetermined predetermined participant predetermined Egea PF., Stroud RM. DIP original experiment: DIP-220018X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Lateral opening of a translocon upon entry of protein suggests the mechanism of insertion into membranes. Lateral opening of a translocon upon entry of protein suggests the mechanism of insertion into membranes. Lateral opening of a translocon upon entry of protein suggests the mechanism of insertion into membranes. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Egea PF., Stroud RM. Only protein-protein interactions ecolx Escherichia coli pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Egea PF., Stroud RM. DIP original experiment: DIP-220019X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Lateral opening of a translocon upon entry of protein suggests the mechanism of insertion into membranes. Lateral opening of a translocon upon entry of protein suggests the mechanism of insertion into membranes. Lateral opening of a translocon upon entry of protein suggests the mechanism of insertion into membranes. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Egea PF., Stroud RM. Only protein-protein interactions ecolx Escherichia coli ion exchange chrom ion exchange chromatography IEC IEC ion exchange chrom predetermined predetermined participant predetermined Egea PF., Stroud RM. DIP original experiment: DIP-220017X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Lateral opening of a translocon upon entry of protein suggests the mechanism of insertion into membranes. Lateral opening of a translocon upon entry of protein suggests the mechanism of insertion into membranes. Lateral opening of a translocon upon entry of protein suggests the mechanism of insertion into membranes. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Egea PF., Stroud RM. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Egea PF., Stroud RM. DIP original experiment: DIP-220016X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Lateral opening of a translocon upon entry of protein suggests the mechanism of insertion into membranes. secg_pyrfu Preprotein translocase subunit SecG secG Protein transport protein Sec61 subunit beta homolog PF2016 protein protein pyrfu Pyrococcus furiosus MAKEKTTLPPTGAGLMRFFDEDTKAVKVTPKGALAIVLVFILIEVLLQIIGPRIFG DIP protein Q8TZH7 original sequence version: 45 secy_ecoli Protein translocase subunit SecY secY prlA b3300 JW3262 protein protein ecoli Escherichia coli (strain K12) MAKQPGLDFQSAKGGLGELKRRLLFVIGALIVFRIGSFIPIPGIDAAVLAKLLEQQRGTIIEMFNMFSGGALSRASIFALGIMPYISASIIIQLLTVVHPTLAEIKKEGESGRRKISQYTRYGTLVLAIFQSIGIATGLPNMPGMQGLVINPGFAFYFTAVVSLVTGTMFLMWLGEQITERGIGNGISIIIFAGIVAGLPPAIAHTIEQARQGDLHFLVLLLVAVLVFAVTFFVVFVERGQRRIVVNYAKRQQGRRVYAAQSTHLPLKVNMAGVIPAIFASSIILFPATIASWFGGGTGWNWLTTISLYLQPGQPLYVLLYASAIIFFCFFYTALVFNPRETADNLKKSGAFVPGIRPGEQTAKYIDKVMTRLTLVGALYITFICLIPEFMRDAMKVPFYFGGTSLLIVVVVIMDFMAQVQTLMMSSQYESALKKANLKGYGR DIP protein P0AGA2 original sequence version: 78 DIP protein P0AGA2 original sequence version: 60 DIP protein P0AGA2 original sequence version: 41 DIP protein P0AGA2 original sequence version: 56 DIP protein P0AGA2 original sequence version: 49 711CA63CD8809763 secy_pyrfu Protein translocase subunit SecY secY Protein transport protein SEC61 subunit alpha homolog PF1801 protein protein pyrfu Pyrococcus furiosus MGARDIIYALERWFPEVERPKRRVPLRERFMWTGVALILYYVLAEIPVYGIPERIQDYFQFLRVVLAGRNGSILTLGIGPIVTAGIILQLLVGSEIIKLDLANPEDRRFYQALQRVFSVFMCFFEAAVWILGGAFGRVGVDVTYAIAVLMILQLAMGGIVLIILDELVSKWGIGSGISLFIAAGVSQTILTRSLNPLTDPNIIDPLTGQPAIVGAIPYFIQHILKGDLWGAIYRGGSAPDMLSVVATIVVFFIVVYFESMRVEIPLGYRGVTVRGSYPIRFLYVSNIPIILTFALYANIQLWARVLDRLGHPWLGRFDPTTGSPISGFVLYVIPPRNIFSVIDNPVRAIVYLILTVIFSLLFGYLWVELTGLDARSIARQLQRAGLQIPGFRRDPRTLEKVLQRYIPYVTFWGSLTVALIAVLADFLGALGTGTGILLTVGILYRFYEEIAREQITEMFPALRKLFGA DIP protein Q8U019 original sequence version: 54 7969DCB9C1983F68 sece_ecoli Protein translocase subunit SecE JW3944 b3981 secE prlG protein protein ecoli Escherichia coli (strain K12) MSANTEAQGSGRGLEAMKWVVVVALLLVAIVGNYLYRDIMLPLRALAVVILIAAAGGVALLTTKGKATVAFAREARTEVRKVIWPTRQETLHTTLIVAAVTAVMSLILWGLDGILVRLVSFITGLRF DIP protein P0AG96 original sequence version: 42 DIP protein P0AG96 original sequence version: 58 DIP protein P0AG96 original sequence version: 50 94D37280522875CE secg_ecoli Protein-export membrane protein SecG P12 Preprotein translocase band 1 subunit JW3142 b3175 secG protein protein ecoli Escherichia coli (strain K12) MYEALLVVFLIVAIGLVGLIMLQQGKGADMGASFGAGASATLFGSSGSGNFMTRMTALLATLFFIISLVLGNINSNKTNKGSEWENLSAPAKTEQTQPAAPAKPTSDIPN DIP protein P0AG99 original sequence version: 77 DIP protein P0AG99 original sequence version: 39 DIP protein P0AG99 original sequence version: 54 DIP protein P0AG99 original sequence version: 46 8DC7663F94D32F2F sece_pyrfu Protein translocase subunit SecE secE Protein transport protein Sec61 gamma subunit homolog PF1989 protein protein pyrfu Pyrococcus furiosus MAELQERIRHFWKESRRAFLVTKKPNWATYKRAAKITGLGIILIGLIGMLIRIVGILILGG DIP protein Q8TZK2 original sequence version: 57 77791007C8F416B6 sece-secy-4 2 9 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 12 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction sece-secg-3 4 7 unspecified role unspecified role prey prey ecolx Escherichia coli 9 unspecified role unspecified role prey prey Region 1-453 Region 1-453 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 12 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli association association secy-sece-4 3 7 unspecified role unspecified role prey prey ecolx Escherichia coli 9 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecolx Escherichia coli 12 unspecified role unspecified role prey prey ecolx Escherichia coli association association sece-secg-4 6 7 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 9 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 12 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association sece-secg-5 1 8 unspecified role unspecified role prey prey Region 1-423 Region 1-423 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 11 unspecified role unspecified role prey prey ecolx Escherichia coli 10 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli association association sece-secg-6 5 7 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 9 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 12 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli association association