DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Structural basis of Na(+)-independent and cooperative substrate/product antiport in CaiT. Structural basis of Na(+)-independent and cooperative substrate/product antiport in CaiT. Nature 2010 imex curation Schulze S., Köster S., Geldmacher U., Terwisscha van Scheltinga AC., Kühlbrandt W. Only protein-protein interactions ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Schulze S., Köster S., Geldmacher U., Terwisscha van Scheltinga AC., Kühlbrandt W. DIP original experiment: DIP-219374X Nature 2010 IMEx Structural basis of Na(+)-independent and cooperative substrate/product antiport in CaiT. Structural basis of Na(+)-independent and cooperative substrate/product antiport in CaiT. Structural basis of Na(+)-independent and cooperative substrate/product antiport in CaiT. Nature 2010 imex curation Schulze S., Köster S., Geldmacher U., Terwisscha van Scheltinga AC., Kühlbrandt W. Only protein-protein interactions ecolx Escherichia coli bn-page blue native page bn-page predetermined predetermined participant predetermined Schulze S., Köster S., Geldmacher U., Terwisscha van Scheltinga AC., Kühlbrandt W. DIP original experiment: DIP-219376X Nature 2010 IMEx Structural basis of Na(+)-independent and cooperative substrate/product antiport in CaiT. Structural basis of Na(+)-independent and cooperative substrate/product antiport in CaiT. Structural basis of Na(+)-independent and cooperative substrate/product antiport in CaiT. Nature 2010 imex curation Schulze S., Köster S., Geldmacher U., Terwisscha van Scheltinga AC., Kühlbrandt W. Only protein-protein interactions ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Schulze S., Köster S., Geldmacher U., Terwisscha van Scheltinga AC., Kühlbrandt W. DIP original experiment: DIP-219375X Nature 2010 IMEx Structural basis of Na(+)-independent and cooperative substrate/product antiport in CaiT. cait_ecoli L-carnitine/gamma-butyrobetaine antiporter caiT yaaP b0040 JW0039 protein protein ecoli Escherichia coli (strain K12) MKNEKRKTGIEPKVFFPPLIIVGILCWLTVRDLDAANVVINAVFSYVTNVWGWAFEWYMVVMLFGWFWLVFGPYAKKRLGNEPPEFSTASWIFMMFASCTSAAVLFWGSIEIYYYISTPPFGLEPNSTGAKELGLAYSLFHWGPLPWATYSFLSVAFAYFFFVRKMEVIRPSSTLVPLVGEKHAKGLFGTIVDNFYLVALIFAMGTSLGLATPLVTECMQWLFGIPHTLQLDAIIITCWIILNAICVACGLQKGVRIASDVRSYLSFLMLGWVFIVSGASFIMNYFTDSVGMLLMYLPRMLFYTDPIAKGGFPQGWTVFYWAWWVIYAIQMSIFLARISRGRTVRELCFGMVLGLTASTWILWTVLGSNTLLLIDKNIINIPNLIEQYGVARAIIETWAALPLSTATMWGFFILCFIATVTLVNACSYTLAMSTCREVRDGEEPPLLVRIGWSILVGIIGIVLLALGGLKPIQTAIIAGGCPLFFVNIMVTLSFIKDAKQNWKD DIP protein P31553 original sequence version: 90 c2llr0_promi L-carnitine/gamma-butyrobetaine antiporter caiT HMPREF0693_2800 protein protein proteus mirabilis atcc 29906 Proteus mirabilis ATCC 29906 MSKDNKKAGIEPKVFFPPLIIVGILCWLTVRDLDASNEVINAVFSYVTNVWGWAFEWYMVIMFGGWFWLVFGRYAKKRLGDEKPEFSTASWIFMMFASCTSAAVLFWGSIEIYYYISSPPFGMEGYSAPAKEIGLAYSLFHWGPLPWATYSFLSVAFAYFFFVRKMEVIRPSSTLTPLVGEKHVNGLFGTVVDNFYLVALILAMGTSLGLATPLVTECIQYLFGIPHTLQLDAIIISCWILLNAICVAFGLQKGVKIASDVRTYLSFLMLGWVFIVGGASFIVNYFTDSVGTLLMYMPRMLFYTDPIGKGGFPQAWTVFYWAWWVIYAIQMSIFLARISKGRTVRELCLGMVSGLTAGTWLIWTILGGNTLQLIDQNILNIPQLIDQYGVPRAIIETWAALPLSTATMWGFFILCFIATVTLINACSYTLAMSTCRSMKEGAEPPLLVRIGWSVLVGIIGIILLALGGLKPIQTAIIAGGCPLFFVNIMVTLSFIKDAKVHWKD DIP protein C2LLR0 original sequence version: 6 The sequence has been withdrawn from uniprot. cait-1 1 4 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction cait-2 3 5 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction cait-3 2 5 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction