DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Structural diversity in free and bound states of intrinsically disordered protein phosphatase 1 regulators. Structural diversity in free and bound states of intrinsically disordered protein phosphatase 1 regulators. Structure (London, England : 1993) 2010 imex curation Marsh JA., Dancheck B., Ragusa MJ., Allaire M., Forman-Kay JD., Peti W. Only protein-protein interactions in vitro In vitro saxs x ray scattering saxs predetermined predetermined participant predetermined Marsh JA., Dancheck B., Ragusa MJ., Allaire M., Forman-Kay JD., Peti W. DIP original experiment: DIP-217169X Structure (London, England : 1993) 2010 IMEx Structural diversity in free and bound states of intrinsically disordered protein phosphatase 1 regulators. Structural diversity in free and bound states of intrinsically disordered protein phosphatase 1 regulators. Structural diversity in free and bound states of intrinsically disordered protein phosphatase 1 regulators. Structure (London, England : 1993) 2010 imex curation Marsh JA., Dancheck B., Ragusa MJ., Allaire M., Forman-Kay JD., Peti W. Only protein-protein interactions in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Marsh JA., Dancheck B., Ragusa MJ., Allaire M., Forman-Kay JD., Peti W. DIP original experiment: DIP-217168X Structure (London, England : 1993) 2010 IMEx Structural diversity in free and bound states of intrinsically disordered protein phosphatase 1 regulators. Structural diversity in free and bound states of intrinsically disordered protein phosphatase 1 regulators. Structural diversity in free and bound states of intrinsically disordered protein phosphatase 1 regulators. Structure (London, England : 1993) 2010 imex curation Marsh JA., Dancheck B., Ragusa MJ., Allaire M., Forman-Kay JD., Peti W. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Marsh JA., Dancheck B., Ragusa MJ., Allaire M., Forman-Kay JD., Peti W. DIP original experiment: DIP-217167X Structure (London, England : 1993) 2010 IMEx Structural diversity in free and bound states of intrinsically disordered protein phosphatase 1 regulators. Structural diversity in free and bound states of intrinsically disordered protein phosphatase 1 regulators. Structural diversity in free and bound states of intrinsically disordered protein phosphatase 1 regulators. Structure (London, England : 1993) 2010 imex curation Marsh JA., Dancheck B., Ragusa MJ., Allaire M., Forman-Kay JD., Peti W. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Marsh JA., Dancheck B., Ragusa MJ., Allaire M., Forman-Kay JD., Peti W. DIP original experiment: DIP-217166X Structure (London, England : 1993) 2010 IMEx Structural diversity in free and bound states of intrinsically disordered protein phosphatase 1 regulators. pp1a_human Serine/threonine-protein phosphatase PP1-alpha catalytic subunit PPP1CA PPP1A protein protein human Homo sapiens Human MSDSEKLNLDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKNKGKYGQFSGLNPGGRPITPPRNSAKAKK DIP protein P62136 original sequence version: 72 DIP protein P62136 original sequence version: 76 DIP protein P62136 original sequence version: 123 DIP protein P62136 original sequence version: 126 DIP protein P62136-1 original sequence version: 98 60C37E1AD9831DAC ipp2_human Protein phosphatase inhibitor 2 PPP1R2 IPP2 protein protein human Homo sapiens Human MAASTASHRPIKGILKNKTSTTSSMVASAEQPRGNVDEELSKKSQKWDEMNILATYHPADKDYGLMKIDEPSTPYHSMMGDDEDACSDTEATEAMAPDILARKLAAAEGLEPKYRIQEQESSGEEDSDLSPEEREKKRQFEMKRKLHYNEGLNIKLARQLISKDLHDDDEDEEMLETADGESMNTEESNQGSTPSDQQQNKLRSS DIP protein P41236 original sequence version: 99 FFC005B07CD5ABFC ppp1ca-ppp1r2-3 2 6 unspecified role unspecified role unspecified role unspecified role Region 9-164 Region 9-164 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 5 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction ppp1ca-ppp1r2-4 4 6 unspecified role unspecified role prey prey Region 9-164 Region 9-164 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 5 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli physical association physical association ppp1ca-ppp1r2-5 1 6 unspecified role unspecified role unspecified role unspecified role Region 9-164 Region 9-164 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 5 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction ppp1ca-ppp1r2-6 3 6 unspecified role unspecified role unspecified role unspecified role Region 9-164 Region 9-164 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 5 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction