DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu VIVID interacts with the WHITE COLLAR complex and FREQUENCY-interacting RNA helicase to alter light and clock responses in Neurospora. VIVID interacts with the WHITE COLLAR complex and FREQUENCY-interacting RNA helicase to alter light and clock responses in Neurospora. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Hunt SM., Thompson S., Elvin M., Heintzen C. Only protein-protein interactions neucs Neurospora crassa anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Hunt SM., Thompson S., Elvin M., Heintzen C. DIP original experiment: DIP-219986X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx VIVID interacts with the WHITE COLLAR complex and FREQUENCY-interacting RNA helicase to alter light and clock responses in Neurospora. VIVID interacts with the WHITE COLLAR complex and FREQUENCY-interacting RNA helicase to alter light and clock responses in Neurospora. VIVID interacts with the WHITE COLLAR complex and FREQUENCY-interacting RNA helicase to alter light and clock responses in Neurospora. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Hunt SM., Thompson S., Elvin M., Heintzen C. Only protein-protein interactions neucs Neurospora crassa anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Hunt SM., Thompson S., Elvin M., Heintzen C. DIP original experiment: DIP-219987X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx VIVID interacts with the WHITE COLLAR complex and FREQUENCY-interacting RNA helicase to alter light and clock responses in Neurospora. VIVID interacts with the WHITE COLLAR complex and FREQUENCY-interacting RNA helicase to alter light and clock responses in Neurospora. VIVID interacts with the WHITE COLLAR complex and FREQUENCY-interacting RNA helicase to alter light and clock responses in Neurospora. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Hunt SM., Thompson S., Elvin M., Heintzen C. Only protein-protein interactions neucs Neurospora crassa anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Hunt SM., Thompson S., Elvin M., Heintzen C. DIP original experiment: DIP-219990X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx VIVID interacts with the WHITE COLLAR complex and FREQUENCY-interacting RNA helicase to alter light and clock responses in Neurospora. VIVID interacts with the WHITE COLLAR complex and FREQUENCY-interacting RNA helicase to alter light and clock responses in Neurospora. VIVID interacts with the WHITE COLLAR complex and FREQUENCY-interacting RNA helicase to alter light and clock responses in Neurospora. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Hunt SM., Thompson S., Elvin M., Heintzen C. Only protein-protein interactions neucs Neurospora crassa anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Hunt SM., Thompson S., Elvin M., Heintzen C. DIP original experiment: DIP-219991X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx VIVID interacts with the WHITE COLLAR complex and FREQUENCY-interacting RNA helicase to alter light and clock responses in Neurospora. VIVID interacts with the WHITE COLLAR complex and FREQUENCY-interacting RNA helicase to alter light and clock responses in Neurospora. VIVID interacts with the WHITE COLLAR complex and FREQUENCY-interacting RNA helicase to alter light and clock responses in Neurospora. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Hunt SM., Thompson S., Elvin M., Heintzen C. Only protein-protein interactions neucs Neurospora crassa anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Hunt SM., Thompson S., Elvin M., Heintzen C. DIP original experiment: DIP-219989X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx VIVID interacts with the WHITE COLLAR complex and FREQUENCY-interacting RNA helicase to alter light and clock responses in Neurospora. VIVID interacts with the WHITE COLLAR complex and FREQUENCY-interacting RNA helicase to alter light and clock responses in Neurospora. VIVID interacts with the WHITE COLLAR complex and FREQUENCY-interacting RNA helicase to alter light and clock responses in Neurospora. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Hunt SM., Thompson S., Elvin M., Heintzen C. Only protein-protein interactions neucs Neurospora crassa anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Hunt SM., Thompson S., Elvin M., Heintzen C. DIP original experiment: DIP-219988X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx VIVID interacts with the WHITE COLLAR complex and FREQUENCY-interacting RNA helicase to alter light and clock responses in Neurospora. q873j5_neucs B9B11.040 frh NCU03363.1 protein protein neucs Neurospora crassa MDDLFEVFEEQPRAQKKRKASPDVEMADGAAAAAPVANAAAAVTHPQAQAAPAPQKDNIDNNDNNNNNTTTSAVQPTIPNGDAAAAADDVQSPQSPHGLGDNKRRKKTDEAEPIMTDAFQTAESREVTGAQGFAPTEGESIVLSHNIQHQVALPPDLDYEYIPLSEHKPPAEPARTYSFKLDPFQALSVASIEREESVLVSAHTSAGKTVVAEYAIAQCLKKNQRVIYTSPIKALSNQKYRDFQAEFGDVGLMTGDVTINPTASCLVMTTEILRSMLYRGSEIMREVAWVVFDEIHYMRDKIRGVVWEETIILLPDKVRYVFLSATIPNAFQFAEWIAKIHRQACHVVYTDFRPTPLQNYFFPAGGKGILLIVDEKGNFKENNFNQAMAMIEEKKGTDSNDWSAKQKGKGKNKKTNKGGEAADEKADIAKIIKMILKKNFQPVIVFNFSKRECEQMALASSSMKFNAPDEENMVNKVFENALASLSEDDKNLPQISNILPLLRKGIGVHHSGLLPILKETIEILFQEGLIKVLFATETFSIGLNMPARTVVFTQVTKWDGQQRRPLTSSEYIQMAGRAGRRGLDDRGIVIMMVDDKLEPETARAIVVGNQDKLNSAFHLGYNMVLNLLRIEAISPEYMLERCFFQFQNAASVPQLERELISLQQERDAIIIPDESIVKDYYGVRQQLEEYNKDMVFVIQHPQNCLGFFQEGRLIHIKSPSGVDYGWGVLIKHIQRQTPKNGQPPYPEQESYVLDVLLKVSGDFNPKTRGEGPMPEGIMPAGKDSKNARWEVVPCLLNCLRALGQLRVFLPKRLESADEKDGVGKAVDEISRRFPDGIPILDPMENMGINDDSFKKLLRKIEVLESRLVANPLHNSPLLVELWNQYSLKMQLGEQIKEKKKAIARAHSVAQLDELKSRKRVLRRLGFINDAEVVQMKARVACEISSTEGHELLLAELLFNRFFNELSPEICACILSCFIFDEKIETQALKEELAKPFREIQAQARIIAKVSAESKLDVNEDEYVQSLKWQLMETVLAWAQGRPFSEICKMTNVYEGSLIRLFRRLEELLRQMAEAARVMGSEELKDKFELSLSKIRRDIVSFNSLYL DIP protein Q873J5 original sequence version: 62 q9c3y6_neucs vvd G17A4.050 GE21DRAFT_9175 protein protein neucs Neurospora crassa MSHTVNSSTMNPWEVEAYQQYHYDPRTAPTANPLFFHTLYAPGGYDIMGYLIQIMNRPNPQVELGPVDTSCALILCDLKQKDTPIVYASEAFLYMTGYSNAEVLGRNCRFLQSPDGMVKPKSTRKYVDSNTINTMRKAIDRNAEVQVEVVNFKKNGQRFVNFLTMIPVRDETGEYRYSMGFQCETE DIP protein Q9C3Y6 original sequence version: 50 726959348049E2F4 frq_neucr Frequency clock protein frq B13D24.170 NCU02265 protein protein neucr Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) MADSGDKSQGMRPPPFDSRGHPLPRRASPDKSITLENHRLARDTSSRVTSSSALGVTESQPQLKSSPTRRNSSGESEPTNWFNQSNRNPAAAFHDESHIMEVDPPFYQKETDSSNEESRYPPGRNPVHPPGGVQLPGFRPVAAHSSAADDYRSVIDDLTVENKRLKEELKRYKQFGSDVMRKEKLFEIKVHGLPRRKKRELEATLRDFAASLGDSSESTSQRRKTGRHGTAVHSSGVSLSKHDSSSSSRSRPVDSAYNSMSTGRSSHAPHSSGPSLGRPSLTRAKSVGTQKVENYLRDTPDGLLPHHIVMTDKEKKKLVVRRLEQLFTGKISGRNMQRNQSMPSMDAPLAPEGTNMAPPRPPPEGLREACIQLQDGDNPRKNRSSKDNGSASNSGGDQTELGGTGTGSGDGSGSGGRTGNNTSPPGAIAPDQRPTRPRDLDPDRVQIPSENMDYIRHLGLVSPEFLQGSRTSYQDVAPDAEGWVYLNLLCNLAQLHMVNVTPSFIRQAVSEKSTKFQLSADGRKIRWRGGTDGTKFSSDSSEDKSQQSPMTEDTEDGSDKNGRRKKRKTQQASSEIGRFGPSRSPSDTFHYKPMFVHRNSSSIETSLEESMSQGSEDAVDESNMGNSKWDFSGSGTTQQRRKRRYDGAIVYYTGAPFCTDLSGDPGDMSPTAQMTAGREVEGSGSGDEVEHVLQRTLSGSSLPIRPLSDDRARVAEVLDFDPGNPPELVADDGSSPNDEDFVFPWCEDPAKVRIQPIAKEVMEPSGLGGVLPDDHFVMLVTTRRVVRPILQRQLSRSTTSEDTAEFIAERLAAIRTSSPLPPRSHRLTVAPLQVEYVSGQFRRLNPAPLPPPAIFYPPFSTDSSWDDGDDLASDDEEVEEVEEDSYSEGQISRRANPHFSDNNTYMRKDDLAFDTETDVRMDSDDNRLSDSGHNMRAMMPRAEAVDGDDSPLAAVTGKEVDMLHTGSSVATAGGAESGYSSSMEDVSSS EC4E984FAD39F095 mint Circadian clock component involved in the generation of biological rhythms, in particular in rhythm stability, period length, and temperature compensation. Oscillates in abundance with a daily peak early in the morning. Behaves as a negative element in circadian transcriptional loop. May bind to wc2 protein. The complex frq-wc2 may turn off the expression of frq EC4E984FAD39F095 wc2_neucr White collar 2 protein wc-2 B13C5.120 NCU00902 protein protein neucr Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) MSHGQPPPGSSMYGFGAMGMGSGMGSGMGSGMGTGMGTGMGTGMSASQMTSDPQDMMSLLDTSVFPGFDGMSMSLDVGDSMSNPFTPVSVPPPLPAGNAGPSHVGVCGGHGAPDQLFSPDDLIATSMSSAGPMIATPTTTTSGPSGGPSSGGGSTLTEFTKRRNWPAKVVEELQDWEHILDANGRIKHVSPSVEPLTGYKPPEIIDLFLRDLIHPDDVGVFTAELNEAIATGSQLRLFYRFRKKDGNWTIFETVGHAHIAAAKFAPNPQNQSPFCQAVFMMARPYPTKNAGLLDSFLEHKIENERLKRRIAELRREEQEEQEESHRTWRMSQEGRSDVTPSDDTATQMGMTPFYIPMNAQADVMMPPPSQPASSLNIALTRENLEGIAGSRPDSIREKMLRYEGNHADTIEMLTGLKYQEGERSHGITTGNASPTLIKGDAGIAIPLDRDPRTGEKKKKIKVAEEYVCTDCGTLDSPEWRKGPSGPKTLCNACGLRWAKKEKKKNANNNNNGGGIGGHNDIHTPMGDHMG B667BD3171380A18 B667BD3171380A18 wc1_neucr White collar 1 protein wc-1 NCU02356 protein protein neucr Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) MNNNYYGSPLSPEELQHQMHQHQQQQQQQQQQQQQQQQQQQQQQQQQQQQHQHQQQQKTNQHRNAGMMNTPPTTNQGNSTIHASDVTMSGGSDSLDEIIQQNLDEMHRRRSVPQPYGGQTRRLSMFDYANPNDGFSDYQLDNMSGNYGDMTGGMGMSGHSSPYAGQNIMAMSDHSGGYSHMSPNVMGNMMTYPNLNMYHSPPIENPYSSAGLDTIRTDFSMDMNMDSGSVSAASVHPTPGLNKQDDEMMTMEQGFGGGDDANASHQAQQNMGGLTPAMTPAMTPAMTPGVSNFAQGMATPVSQDAASTPATTFQSPSLSATTQTIRIGPPPPPSVTNAPTPAPFTSTPSGGGASQTKSIYSKSGFDMLRALWYVASRKDPKLKLGAVDMSCAFVVCDVTLNDCPIIYVSDNFQNLTGYSRHEIVGRNCRFLQAPDGNVEAGTKREFVENNAVYTLKKTIAEGQEIQQSLINYRKGGKPFLNLLTMIPIPWDTEEIRYFIGFQIDLVECPDAIIGQEGNGPMQVNYTHSDIGQYIWTPPTQKQLEPADGQTLGVDDVSTLLQQCNSKGVASDWHKQSWDKMLLENADDVVHVLSLKGLFLYLSPACKKVLEYDASDLVGTSLSSICHPSDIVPVTRELKEAQQHTPVNIVFRIRRKNSGYTWFESHGTLFNEQGKGRKCIILVGRKRPVFALHRKDLELNGGIGDSEIWTKVSTSGMFLFVSSNVRSLLDLLPENLQGTSMQDLMRKESRAEFGRTIEKARKGKIASCKHEVQNKRGQVLQAYTTFYPGDGGEGQRPTFLLAQTKLLKASSRTLAPATVTVKNMSPGGVPLSPMKGIQTDSDSNTLMGGMSKSGSSDSTGAMVSARSSAGPGQDAALDADNIFDELKTTRCTSWQYELRQMEKVNRMLAEELAQLLSNKKKRKRRKGGGNMVRDCANCHTRNTPEWRRGPSGNRDLCNSCGLRWAKQTGRVSPRTSSRGGNGDSMSKKSNSPSHSSPLHREVGNDSPSTTTATKNSPSLRGSSTTAPGTITTDSGPAVASSASGTGSTTIATSANSAASTVNALGPPATGPSGGSPAQHLPPHLQGTHLNAQAMQRVHQHKQHQQHQQQHQQQHQQQHQQQHQQLQQHQFNPPQSQPLLEGGSGFRGSGMEMTSIREEMGEHQQGLSV 6489D04DAB50EE38 6489D04DAB50EE38 b9b11.040-frq-1 1 9 unspecified role unspecified role prey prey neucs Neurospora crassa 7 unspecified role unspecified role bait bait neucs Neurospora crassa physical association physical association b9b11.040-vvd-1 6 8 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range neucs Neurospora crassa 7 unspecified role unspecified role bait bait neucs Neurospora crassa physical association physical association wc1-wc2-1 3 10 unspecified role unspecified role prey prey neucs Neurospora crassa 11 unspecified role unspecified role bait bait neucs Neurospora crassa physical association physical association wc1-vvd-3 4 11 unspecified role unspecified role bait bait neucs Neurospora crassa 8 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range neucs Neurospora crassa physical association physical association wc1-vvd-4 5 10 unspecified role unspecified role prey prey neucs Neurospora crassa 11 unspecified role unspecified role bait bait neucs Neurospora crassa 8 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range neucs Neurospora crassa association association b9b11.040-frq-2 2 9 unspecified role unspecified role prey prey neucs Neurospora crassa 8 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range neucs Neurospora crassa 7 unspecified role unspecified role bait bait neucs Neurospora crassa association association