DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Membrane-shaping host reticulon proteins play crucial roles in viral RNA replication compartment formation and function. Membrane-shaping host reticulon proteins play crucial roles in viral RNA replication compartment formation and function. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Diaz A., Wang X., Ahlquist P. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Diaz A., Wang X., Ahlquist P. DIP original experiment: DIP-219982X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Membrane-shaping host reticulon proteins play crucial roles in viral RNA replication compartment formation and function. Membrane-shaping host reticulon proteins play crucial roles in viral RNA replication compartment formation and function. Membrane-shaping host reticulon proteins play crucial roles in viral RNA replication compartment formation and function. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Diaz A., Wang X., Ahlquist P. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Diaz A., Wang X., Ahlquist P. DIP original experiment: DIP-219979X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Membrane-shaping host reticulon proteins play crucial roles in viral RNA replication compartment formation and function. Membrane-shaping host reticulon proteins play crucial roles in viral RNA replication compartment formation and function. Membrane-shaping host reticulon proteins play crucial roles in viral RNA replication compartment formation and function. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Diaz A., Wang X., Ahlquist P. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Diaz A., Wang X., Ahlquist P. DIP original experiment: DIP-219978X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Membrane-shaping host reticulon proteins play crucial roles in viral RNA replication compartment formation and function. Membrane-shaping host reticulon proteins play crucial roles in viral RNA replication compartment formation and function. Membrane-shaping host reticulon proteins play crucial roles in viral RNA replication compartment formation and function. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Diaz A., Wang X., Ahlquist P. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Diaz A., Wang X., Ahlquist P. DIP original experiment: DIP-219970X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Membrane-shaping host reticulon proteins play crucial roles in viral RNA replication compartment formation and function. Membrane-shaping host reticulon proteins play crucial roles in viral RNA replication compartment formation and function. Membrane-shaping host reticulon proteins play crucial roles in viral RNA replication compartment formation and function. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Diaz A., Wang X., Ahlquist P. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Diaz A., Wang X., Ahlquist P. DIP original experiment: DIP-219974X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Membrane-shaping host reticulon proteins play crucial roles in viral RNA replication compartment formation and function. Membrane-shaping host reticulon proteins play crucial roles in viral RNA replication compartment formation and function. Membrane-shaping host reticulon proteins play crucial roles in viral RNA replication compartment formation and function. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Diaz A., Wang X., Ahlquist P. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Diaz A., Wang X., Ahlquist P. DIP original experiment: DIP-219973X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Membrane-shaping host reticulon proteins play crucial roles in viral RNA replication compartment formation and function. Membrane-shaping host reticulon proteins play crucial roles in viral RNA replication compartment formation and function. Membrane-shaping host reticulon proteins play crucial roles in viral RNA replication compartment formation and function. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Diaz A., Wang X., Ahlquist P. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Diaz A., Wang X., Ahlquist P. DIP original experiment: DIP-219971X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Membrane-shaping host reticulon proteins play crucial roles in viral RNA replication compartment formation and function. Membrane-shaping host reticulon proteins play crucial roles in viral RNA replication compartment formation and function. Membrane-shaping host reticulon proteins play crucial roles in viral RNA replication compartment formation and function. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Diaz A., Wang X., Ahlquist P. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Diaz A., Wang X., Ahlquist P. DIP original experiment: DIP-219976X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Membrane-shaping host reticulon proteins play crucial roles in viral RNA replication compartment formation and function. Membrane-shaping host reticulon proteins play crucial roles in viral RNA replication compartment formation and function. Membrane-shaping host reticulon proteins play crucial roles in viral RNA replication compartment formation and function. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Diaz A., Wang X., Ahlquist P. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Diaz A., Wang X., Ahlquist P. DIP original experiment: DIP-219983X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Membrane-shaping host reticulon proteins play crucial roles in viral RNA replication compartment formation and function. Membrane-shaping host reticulon proteins play crucial roles in viral RNA replication compartment formation and function. Membrane-shaping host reticulon proteins play crucial roles in viral RNA replication compartment formation and function. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Diaz A., Wang X., Ahlquist P. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Diaz A., Wang X., Ahlquist P. DIP original experiment: DIP-219972X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Membrane-shaping host reticulon proteins play crucial roles in viral RNA replication compartment formation and function. Membrane-shaping host reticulon proteins play crucial roles in viral RNA replication compartment formation and function. Membrane-shaping host reticulon proteins play crucial roles in viral RNA replication compartment formation and function. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Diaz A., Wang X., Ahlquist P. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Diaz A., Wang X., Ahlquist P. DIP original experiment: DIP-219975X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Membrane-shaping host reticulon proteins play crucial roles in viral RNA replication compartment formation and function. Membrane-shaping host reticulon proteins play crucial roles in viral RNA replication compartment formation and function. Membrane-shaping host reticulon proteins play crucial roles in viral RNA replication compartment formation and function. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Diaz A., Wang X., Ahlquist P. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Diaz A., Wang X., Ahlquist P. DIP original experiment: DIP-219981X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Membrane-shaping host reticulon proteins play crucial roles in viral RNA replication compartment formation and function. Membrane-shaping host reticulon proteins play crucial roles in viral RNA replication compartment formation and function. Membrane-shaping host reticulon proteins play crucial roles in viral RNA replication compartment formation and function. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Diaz A., Wang X., Ahlquist P. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Diaz A., Wang X., Ahlquist P. DIP original experiment: DIP-219980X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Membrane-shaping host reticulon proteins play crucial roles in viral RNA replication compartment formation and function. Membrane-shaping host reticulon proteins play crucial roles in viral RNA replication compartment formation and function. Membrane-shaping host reticulon proteins play crucial roles in viral RNA replication compartment formation and function. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Diaz A., Wang X., Ahlquist P. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Diaz A., Wang X., Ahlquist P. DIP original experiment: DIP-219977X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Membrane-shaping host reticulon proteins play crucial roles in viral RNA replication compartment formation and function. rtn2_yeast Reticulon-like protein 2 RTN2 D1062 YDL204W protein protein yeast Saccharomyces cerevisiae Baker's yeast MNRNTTTNKNANLNNSRNANAPGEAGHQNKTGLIYWTNPSKSGASFAATLVSLLILRNVNVISVLLKIGYMVLFTSFAVELSTKVLFDKGVVSRFGMQESPDLVGVLKPHIDRELDRLPALEDRIRKLVFAHRTRNNFTIGVSLYFLHGLFAIFSMNTVLIMTTIFLYTVPLIYDRKQARIDRAIDRMKDLVIHRFHKNYNKVVEKTEPYIDKIIPPQTDEGSYSTSISNENKSSTSQRNKSGLSSSEFDNMNDTSASKSGKDSYSTSQYNRAEYPVSQNENIGTLKSGKQEIPTEKDFNNRHENFSKPDVKTYDPRTVDIEEELAAHQRELEQNLKDGDYNLVGSKEIPDPITVPAPTRHTTKPAESQSIPIKNNETLHKTTHGLKQKLQHA E937E2B77759DFF5 E937E2B77759DFF5 yop1_yeast Protein YOP1 YOP1 YIP2 YPR028W YP9367.08 YIP1 partner protein 1 YPT-interacting protein 2 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSEYASSIHSQMKQFDTKYSGNRILQQLENKTNLPKSYLVAGLGFAYLLLIFINVGGVGEILSNFAGFVLPAYLSLVALKTPTSTDDTQLLTYWIVFSFLSVIEFWSKAILYLIPFYWFLKTVFLIYIALPQTGGARMIYQKIVAPLTDRYILRDVSKTEKDEIRASVNEASKATGASVH 6F1073444B653CCF 6F1073444B653CCF rdrp_bmv RNA-directed RNA polymerase 2a ORF2a protein protein bmv Brome mosaic virus BMV MSSKTWDDDFVRQVPSFQWIIDQSLEDEVEAASLQVQEPADGVAIDGSLASFKLAIAPLEIGGVFDPPFDRVRWGSICDTVQQMVQQFTDRPLIPQAEMARMLYLDIPGSFVLEDEIDDWYPEDTSDGYGVSFAADEDHASDLKLASDSSNCEIEEVRVTGDTPKELTLGDRYMGIDEEFQTTNTDYDITLQIMNPIEHRVSRVIDTHCHPDNPDISTGPIYMERVSLARTEATSHSILPTHAYFDDSYHQALVENGDYSMDFDRIRLKQSDVDWYRDPDKYFQPKMNIGSAQRRVGTQKEVLTALKKRNADVPEMGDAINMKDTAKAIAKRFRSTFLNVDGEDCLRASMDVMTKCLEYHKKWGKHMDLQGVNVAAETDLCRYQHMLKSDVKPVVTDTLHLERAVAATITFHSKGVTSNFSPFFTACFEKLSLALKSRFIVPIGKISSLELKNVRLNNRYFLEADLSKFDKSQGELHLEFQREILLALGFPAPLTNWWSDFHRDSYLSDPHAKVGMSVSFQRRTGDAFTYFGNTLVTMAMIAYASDLSDCDCAIFSGDDSLIISKVKPVLDTDMFTSLFNMEIKVMDPSVPYVCSKFLVETEMGNLVSVPDPLREIQRLAKRKILRDEQMLRAHFVSFCDRMKFINQLDEKMITTLCHFVYLKYGKEKPWIFEEVRAALAAFSLYSENFLRFSDCYCTEGIRVYQMSDPVCKFKRTTEERKTDGDWFHNWKNPKFPGVLDKVYRTIGIYSSDCSTKELPVKRIGRLHEALERESLKLANDRRTTQRLKKKVDDYATGRGGLTSVDALLVKSHCETFKPSDLR DIP protein P03594 original sequence version: 61 rtn1_yeast Reticulon-like protein 1 RTN1 YDR233C protein protein yeast Saccharomyces cerevisiae Baker's yeast MSASAQHSQAQQQQQQKSCNCDLLLWRNPVQTGKYFGGSLLALLILKKVNLITFFLKVAYTILFTTGSIEFVSKLFLGQGLITKYGPKECPNIAGFIKPHIDEALKQLPVFQAHIRKTVFAQVPKHTFKTAVALFLLHKFFSWFSIWTIVFVADIFTFTLPVIYHSYKHEIDATVAQGVEISKQKTQEFSQMACEKTKPYLDKVESKLGPISNLVKSKTAPVSSTAGPQTASTSKLAADVPLEPESKAYTSSAQVMPEVPQHEPSTTQEFNVDELSNELKKSTKNLQNELEKNNA 245575E65D3C2193 245575E65D3C2193 1a_bmv Replication protein 1a ORF1a protein protein bmv Brome mosaic virus BMV MSSSIDLLKLIAEKGADSQSAQDIVDNQVAQQLSAQIEYAKRSKKINVRNKLSIEEADAFRDRYGGAFDLNLTQQYHAPHSLAGALRVAEHYDCLDSFPPEDPVIDFGGSWWHHFSRRDKRVHSCCPVLGVRDAARHEERMCRMRKILQESDDFDEVPNFCLNRAQDCDVQADWAICIHGGYDMGFQGLCDAMHSHGVRVLRGTVMFDGAMLFDREGFLPLLKCHWQRDGSGADEVIKFDFENESTLSYIHGWQDLGSFFTESVHCIDGTTYLLEREMLKCNIMTYKIIATNLRCPRETLRHCVWFEDISKYVGVSIPEDWSLNRWKCVRVAKTTVREVEEIAFRCFKESKEWTENMKAVASILSAKSSTVIINGQAIMAGERLDIEDYHLVAFALTLNLYQKYEKLTALRDGMEWKGWCHHFKTRFWWGGDSSRAKVGWLRTLASRFPLLRLDSYADSFKFLTRLSNVEEFEQDSVPISRLRTFWTEEDLFDRLEHEVQTAKTKRSKKKAKVPPAAEIPQEEFHDAPESSSPESVSDDVKPVTDVVPDAEVSVEVPTDPRGISRHGAMKEFVRYCKRLHNNSESNLRHLWDISGGRGSEIANKSIFETYHRIDDMVNVHLANGNWLYPKKYDYTVGYNEHGLGPKHADETYIVDKTCACSNLRDIAEASAKVSVPTCDISMVDGVAGCGKTTAIKDAFRMGEDLIVTANRKSAEDVRMALFPDTYNSKVALDVVRTADSAIMHGVPSCHRLLVDEAGLLHYGQLLVVAALSKCSQVLAFGDTEQISFKSRDAGFKLLHGNLQYDRRDVVHKTYRCPQDVIAAVNLLKRKCGNRDTKYQSWTSESKVSRSLTKRRITSGLQVTIDPNRTYLTMTQADKAALQTRAKDFPVSKDWIDGHIKTVHEAQGISVDNVTLVRLKSTKCDLFKHEEYCLVALTRHKKSFEYCFNGELAGDLIFNCVK DIP protein P03588 original sequence version: 55 1a_bmv-rtn1p-1 4 18 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 19 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association 1a_bmv-yop1p-1 13 16 unspecified role unspecified role prey prey GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 19 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association 1a_bmv-rtn2p-1 2 15 unspecified role unspecified role prey prey GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 19 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association yop1p-1a_bmv-1 11 16 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 19 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association 1a_bmv-rtn2p-2 7 15 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 19 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association 1a_bmv-rdrp_bmv-1 8 17 unspecified role unspecified role prey prey GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 19 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association rtn1p-1a_bmv-1 12 18 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 19 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association 1a_bmv-yop1p-2 10 16 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 19 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association rtn2p-1a_bmv-1 1 15 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 19 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association rdrp_bmv-1a_bmv-1 14 17 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 19 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association rtn1p-1a_bmv-2 6 18 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 19 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association yop1p-1a_bmv-2 9 16 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 19 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association 1a_bmv-rtn1p-2 3 18 unspecified role unspecified role prey prey GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 19 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association rtn2p-1a_bmv-2 5 15 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 19 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association