DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu H-NS forms a superhelical protein scaffold for DNA condensation. H-NS forms a superhelical protein scaffold for DNA condensation. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Arold ST., Leonard PG., Parkinson GN., Ladbury JE. Only protein-protein interactions ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Arold ST., Leonard PG., Parkinson GN., Ladbury JE. DIP original experiment: DIP-219957X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx H-NS forms a superhelical protein scaffold for DNA condensation. H-NS forms a superhelical protein scaffold for DNA condensation. H-NS forms a superhelical protein scaffold for DNA condensation. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Arold ST., Leonard PG., Parkinson GN., Ladbury JE. Only protein-protein interactions ecolx Escherichia coli saxs x ray scattering saxs predetermined predetermined participant predetermined Arold ST., Leonard PG., Parkinson GN., Ladbury JE. DIP original experiment: DIP-219958X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx H-NS forms a superhelical protein scaffold for DNA condensation. hns_salty DNA-binding protein H-NS hns Histone-like protein HLP-II Protein B1 Protein H1 hnsA osmZ STM1751 protein protein salty Salmonella typhimurium MSEALKILNNIRTLRAQARECTLETLEEMLEKLEVVVNERREEESAAAAEVEERTRKLQQYREMLIADGIDPNELLNSMAAAKSGTKAKRAARPAKYSYVDENGETKTWTGQGRTPAVIKKAMEEQGKQLEDFLIKE A9620E5CC7DD3EB1 h_ns-1 1 3 unspecified role unspecified role unspecified role unspecified role N-terminal domain Region 1-83 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction h_ns-2 2 3 unspecified role unspecified role unspecified role unspecified role N-terminal domain Region 1-83 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction