DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Noninvasive molecular imaging of c-Myc activation in living mice. Noninvasive molecular imaging of c-Myc activation in living mice. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Fan-Minogue H., Cao Z., Paulmurugan R., Chan CT., Massoud TF., Felsher DW., Gambhir SS. Only protein-protein interactions crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster split renilla luciferase complementation Split renilla luciferase complementation renilla luciferase renilla luciferase predetermined predetermined participant predetermined Fan-Minogue H., Cao Z., Paulmurugan R., Chan CT., Massoud TF., Felsher DW., Gambhir SS. DIP original experiment: DIP-219952X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Noninvasive molecular imaging of c-Myc activation in living mice. Noninvasive molecular imaging of c-Myc activation in living mice. Noninvasive molecular imaging of c-Myc activation in living mice. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Fan-Minogue H., Cao Z., Paulmurugan R., Chan CT., Massoud TF., Felsher DW., Gambhir SS. Only protein-protein interactions human Homo sapiens Human split renilla luciferase complementation Split renilla luciferase complementation renilla luciferase renilla luciferase predetermined predetermined participant predetermined Fan-Minogue H., Cao Z., Paulmurugan R., Chan CT., Massoud TF., Felsher DW., Gambhir SS. DIP original experiment: DIP-219953X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Noninvasive molecular imaging of c-Myc activation in living mice. Noninvasive molecular imaging of c-Myc activation in living mice. Noninvasive molecular imaging of c-Myc activation in living mice. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Fan-Minogue H., Cao Z., Paulmurugan R., Chan CT., Massoud TF., Felsher DW., Gambhir SS. Only protein-protein interactions human Homo sapiens Human split renilla luciferase complementation Split renilla luciferase complementation renilla luciferase renilla luciferase predetermined predetermined participant predetermined Fan-Minogue H., Cao Z., Paulmurugan R., Chan CT., Massoud TF., Felsher DW., Gambhir SS. DIP original experiment: DIP-219951X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Noninvasive molecular imaging of c-Myc activation in living mice. p49841-2 Glycogen synthase kinase-3 beta GSK3B Serine/threonine-protein kinase GSK3B GSK-3beta2 neuron-specific protein protein human Homo sapiens Human MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHPWTKDSSGTGHFTSGVRVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAASTPTNATAASDANTGDRGQTNNAASASASNST DIP protein P49841-2 original sequence version: 150 DIP protein P49841-2 original sequence version: 191 May play a specific role in axon growth and neurite outgrowth. Reduced binding to AXIN1, reduced ability to phosphorylate MAPT/TAU. myc_human Myc proto-oncogene protein BHLHE39 Transcription factor p64 MYC Proto-oncogene c-Myc Class E basic helix-loop-helix protein 39 protein protein human Homo sapiens Human MPLNVSFTNRNYDLDYDSVQPYFYCDEEENFYQQQQQSELQPPAPSEDIWKKFELLPTPPLSPSRRSGLCSPSYVAVTPFSLRGDNDGGGGSFSTADQLEMVTELLGGDMVNQSFICDPDDETFIKNIIIQDCMWSGFSAAAKLVSEKLASYQAARKDSGSPNPARGHSVCSTSSLYLQDLSAAASECIDPSVVFPYPLNDSSSPKSCASQDSSAFSPSSDSLLSSTESSPQGSPEPLVLHEETPPTTSSDSEEEQEDEEEIDVVSVEKRQAPGKRSESGSPSAGGHSKPPHSPLVLKRCHVSTHQHNYAAPPSTRKDYPAAKRVKLDSVRVLRQISNNRKCTSPRSSDTEENVKRRTHNVLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILSVQAEEQKLISEEDLLRKRREQLKHKLEQLRNSCA DIP protein P01106 original sequence version: 195 DIP protein P01106 original sequence version: 196 DIP protein P01106 original sequence version: 148 DIP protein P01106-1 original sequence version: 161 DIP protein P01106 original sequence version: 182 DIP protein P01106 original sequence version: 197 DIP protein P01106-1 original sequence version: 208 DIP protein P01106 original sequence version: 121 DIP protein P01106-1 original sequence version: 144 DIP protein P01106 original sequence version: 144 ED5C028029A4C5D1 gsk3b-myc-1 2 5 unspecified role unspecified role unspecified role unspecified role Region 51-69 Region 51-69 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain P01106:p.Thr58Ile T58I mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain T I This feature has been corrected as a result of our quality control procedures. The original label was 'T58I'. Wed May 02 18:10:21 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr58ile' Tue Jun 30 18:42:00 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr58Ile' P01106:p.[Thr58Ile;Ser62Asp] T58I/S62D mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain S D certain certain sequence position certain certain certain sequence position certain T I This feature has been corrected as a result of our quality control procedures. The original label was 'T58I/S62D'. Wed May 02 20:23:06 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr58ile,ser62asp' Tue Jun 30 18:15:40 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Thr58Ile;Ser62Asp]' P01106:p.Ser62Ala S62A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain S A This feature has been corrected as a result of our quality control procedures. The original label was 'S62A'. Wed May 02 19:12:04 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser62ala' Tue Jun 30 18:36:20 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser62Ala' P01106:p.[Thr58Ala;Ser62Ala] T58A/S62A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain S A certain certain sequence position certain certain certain sequence position certain T A This feature has been corrected as a result of our quality control procedures. The original label was 'T58A/S62A'. Wed May 02 15:16:38 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr58ala,ser62ala' Tue Jun 30 18:41:04 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Thr58Ala;Ser62Ala]' P01106:p.Thr58Asp T58D mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain T D This feature has been corrected as a result of our quality control procedures. The original label was 'T58D'. Wed May 02 19:36:13 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr58asp' Tue Jun 30 19:05:29 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr58Asp' P01106:p.[Thr58Asp;Ser62Ala] T58D/S62A mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain S A certain certain sequence position certain certain certain sequence position certain T D This feature has been corrected as a result of our quality control procedures. The original label was 'T58D/S62A'. Wed May 02 14:34:39 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr58asp,ser62ala' Tue Jun 30 19:21:54 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Thr58Asp;Ser62Ala]' human Homo sapiens Human 4 unspecified role unspecified role unspecified role unspecified role Region 35-433 Region 35-433 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human physical association physical association gsk3b-myc-2 3 5 unspecified role unspecified role unspecified role unspecified role Region 51-69 Region 51-69 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human 4 unspecified role unspecified role unspecified role unspecified role Region 35-433 Region 35-433 sufficient to bind sufficient binding region sufficient to bind mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human physical association physical association gsk3b-myc-3 1 5 unspecified role unspecified role unspecified role unspecified role Region 51-69 Region 51-69 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster 4 unspecified role unspecified role unspecified role unspecified role Region 35-433 Region 35-433 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster physical association physical association