DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Structure and function of the polymerase core of TRAMP, a RNA surveillance complex. Structure and function of the polymerase core of TRAMP, a RNA surveillance complex. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Hamill S., Wolin SL., Reinisch KM. Only protein-protein interactions ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Hamill S., Wolin SL., Reinisch KM. DIP original experiment: DIP-219941X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Structure and function of the polymerase core of TRAMP, a RNA surveillance complex. Structure and function of the polymerase core of TRAMP, a RNA surveillance complex. Structure and function of the polymerase core of TRAMP, a RNA surveillance complex. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Hamill S., Wolin SL., Reinisch KM. Only protein-protein interactions ecolx Escherichia coli pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Hamill S., Wolin SL., Reinisch KM. DIP original experiment: DIP-219945X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Structure and function of the polymerase core of TRAMP, a RNA surveillance complex. Structure and function of the polymerase core of TRAMP, a RNA surveillance complex. Structure and function of the polymerase core of TRAMP, a RNA surveillance complex. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Hamill S., Wolin SL., Reinisch KM. Only protein-protein interactions ecolx Escherichia coli pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Hamill S., Wolin SL., Reinisch KM. DIP original experiment: DIP-219944X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Structure and function of the polymerase core of TRAMP, a RNA surveillance complex. Structure and function of the polymerase core of TRAMP, a RNA surveillance complex. Structure and function of the polymerase core of TRAMP, a RNA surveillance complex. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Hamill S., Wolin SL., Reinisch KM. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Hamill S., Wolin SL., Reinisch KM. DIP original experiment: DIP-219942X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Structure and function of the polymerase core of TRAMP, a RNA surveillance complex. Structure and function of the polymerase core of TRAMP, a RNA surveillance complex. Structure and function of the polymerase core of TRAMP, a RNA surveillance complex. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Hamill S., Wolin SL., Reinisch KM. Only protein-protein interactions ecolx Escherichia coli ion exchange chrom ion exchange chromatography IEC IEC ion exchange chrom predetermined predetermined participant predetermined Hamill S., Wolin SL., Reinisch KM. DIP original experiment: DIP-219943X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Structure and function of the polymerase core of TRAMP, a RNA surveillance complex. air2_yeast Protein AIR2 Arginine methyltransferase-interacting RING finger protein 2 AIR2 YDL175C protein protein yeast Saccharomyces cerevisiae Baker's yeast MEKNTAPFVVDTAPTTPPDKLVAPSIEEVNSNPNELRALRGQGRYFGVSDDDKDAIKEAAPKCNNCSQRGHLKKDCPHIICSYCGATDDHYSRHCPKAIQCSKCDEVGHYRSQCPHKWKKVQCTLCKSKKHSKERCPSIWRAYILVDDNEKAKPKVLPFHTIYCYNCGGKGHFGDDCKEKRSSRVPNEDGSAFTGSNLSVELKQEYYRHMNRNSDENEDYQFSESIYDEDPLPRPSHKRHSQNDHSHSGRNKRRASNFHPPPYQKSNVIQPTIRGETLSLNNNISKNSRYQNTKVNVSSISENMYGSRYNPSTYVDNNSISNSSNYRNYNSYQPYRSGTLGKRR 5915C97FA39D6AFC 5915C97FA39D6AFC pap2_yeast Poly(A) RNA polymerase protein 2 TRF4 HRC584 O0716 YOL115W PAP2 DNA polymerase sigma DNA polymerase kappa Topoisomerase 1-related protein TRF4 protein protein yeast Saccharomyces cerevisiae Baker's yeast MGAKSVTASSSKKIKNRHNGKVKKSKKIKKVRKPQKSISLNDENEVEILPSRNEQETNKLPKDHVTADGILVLEHKSDDDEGFDVYDGHFDNPTDIPSTTEESKTPSLAVHGDEKDLANNDDFISLSASSEDEQAEQEEEREKQELEIKKEKQKEILNTDYPWILNHDHSKQKEISDWLTFEIKDFVAYISPSREEIEIRNQTISTIREAVKQLWPDADLHVFGSYSTDLYLPGSDIDCVVTSELGGKESRNNLYSLASHLKKKNLATEVEVVAKARVPIIKFVEPHSGIHIDVSFERTNGIEAAKLIREWLDDTPGLRELVLIVKQFLHARRLNNVHTGGLGGFSIICLVFSFLHMHPRIITNEIDPKDNLGVLLIEFFELYGKNFGYDDVALGSSDGYPVYFPKSTWSAIQPIKNPFSLAIQDPGDESNNISRGSFNIRDIKKAFAGAFDLLTNRCFELHSATFKDRLGKSILGNVIKYRGKARDFKDERGLVLNKAIIENENYHKKRSRIIHDEDFAEDTVTSTATATTTDDDYEITNPPAKKAKIEEKPESEPAKRNSGETYITVSSEDDDEDGYNPYTL 8A58B29E4BFDC022 8A58B29E4BFDC022 air2p-trf4p-1 5 6 unspecified role unspecified role unspecified role unspecified role Zinc-knuckles 4-5 domain Region 119-198 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 7 unspecified role unspecified role unspecified role unspecified role Catalytic and central domains Region 161-481 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction air2p-trf4p-2 1 6 unspecified role unspecified role unspecified role unspecified role Zinc-knuckles 4-5 domain Region 119-198 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 7 unspecified role unspecified role unspecified role unspecified role Catalytic and central domains Region 161-481 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction air2p-trf4p-3 2 6 unspecified role unspecified role bait bait Zinc-knuckles 4-5 domain Region 119-198 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 7 unspecified role unspecified role prey prey Catalytic and central domains Region 161-481 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli physical association physical association trf4p-air2p-1 3 6 unspecified role unspecified role prey prey Zinc-knuckles 4-5 domain Region 119-198 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 7 unspecified role unspecified role bait bait Catalytic and central domains Region 161-481 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli physical association physical association air2p-trf4p-4 4 6 unspecified role unspecified role unspecified role unspecified role Zinc-knuckles 4-5 domain Region 119-198 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 7 unspecified role unspecified role unspecified role unspecified role Catalytic and central domains Region 161-481 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction