DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Identification of RING finger protein 4 (RNF4) as a modulator of DNA demethylation through a functional genomics screen. Identification of RING finger protein 4 (RNF4) as a modulator of DNA demethylation through a functional genomics screen. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Hu XV., Rodrigues TM., Tao H., Baker RK., Miraglia L., Orth AP., Lyons GE., Schultz PG., Wu X. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Hu XV., Rodrigues TM., Tao H., Baker RK., Miraglia L., Orth AP., Lyons GE., Schultz PG., Wu X. DIP original experiment: DIP-219936X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Identification of RING finger protein 4 (RNF4) as a modulator of DNA demethylation through a functional genomics screen. Identification of RING finger protein 4 (RNF4) as a modulator of DNA demethylation through a functional genomics screen. Identification of RING finger protein 4 (RNF4) as a modulator of DNA demethylation through a functional genomics screen. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Hu XV., Rodrigues TM., Tao H., Baker RK., Miraglia L., Orth AP., Lyons GE., Schultz PG., Wu X. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Hu XV., Rodrigues TM., Tao H., Baker RK., Miraglia L., Orth AP., Lyons GE., Schultz PG., Wu X. DIP original experiment: DIP-219938X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Identification of RING finger protein 4 (RNF4) as a modulator of DNA demethylation through a functional genomics screen. Identification of RING finger protein 4 (RNF4) as a modulator of DNA demethylation through a functional genomics screen. Identification of RING finger protein 4 (RNF4) as a modulator of DNA demethylation through a functional genomics screen. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Hu XV., Rodrigues TM., Tao H., Baker RK., Miraglia L., Orth AP., Lyons GE., Schultz PG., Wu X. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Hu XV., Rodrigues TM., Tao H., Baker RK., Miraglia L., Orth AP., Lyons GE., Schultz PG., Wu X. DIP original experiment: DIP-219937X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Identification of RING finger protein 4 (RNF4) as a modulator of DNA demethylation through a functional genomics screen. apex1_human DNA-(apurinic or apyrimidinic site) endonuclease Apurinic-apyrimidinic endonuclease 1 APEX nuclease APE1 APEX1 APE APEX APX HAP1 REF1 REF-1 Redox factor-1 protein protein human Homo sapiens Human MPKRGKKGAVAEDGDELRTEPEAKKSKTAAKKNDKEAAGEGPALYEDPPDQKTSPSGKPATLKICSWNVDGLRAWIKKKGLDWVKEEAPDILCLQETKCSENKLPAELQELPGLSHQYWSAPSDKEGYSGVGLLSRQCPLKVSYGIGDEEHDQEGRVIVAEFDSFVLVTAYVPNAGRGLVRLEYRQRWDEAFRKFLKGLASRKPLVLCGDLNVAHEEIDLRNPKGNKKNAGFTPQERQGFGELLQAVPLADSFRHLYPNTPYAYTFWTYMMNARSKNVGWRLDYFLLSHSLLPALCDSKIRSKALGSDHCPITLYLAL DIP protein P27695 original sequence version: 139 DIP protein P27695 original sequence version: 152 DIP protein P27695 original sequence version: 187 B88579C01BAF80C6 rnf4_rat E3 ubiquitin-protein ligase RNF4 RING finger protein 4 Small nuclear ring finger protein Snurf Rnf4 RING-type E3 ubiquitin transferase RNF4 protein protein rat Rattus norvegicus (Rat) Rat MSTRNPQRKRRGGAVNSRQTQKRTRETTSTPEISLEAEPIELVETVGDEIVDLTCESLEPVVVDLTHNDSVVIVEERRRPRRNGRRLRQDHADSCVVSSDDEELSKDKDVYVTTHTPRSTKDEGTTGLRPSGTVSCPICMDGYSEIVQNGRLIVSTECGHVFCSQCLRDSLKNANTCPTCRKKINHKRYHPIYI DIP protein O88846 original sequence version: 79 DIP protein O88846 original sequence version: 77 mint Enhances steroid receptor-mediated transcriptional activation as well as activating basal transcription 40C13970FC11DFF2 tdg_human G/T mismatch-specific thymine DNA glycosylase TDG Thymine-DNA glycosylase protein protein human Homo sapiens Human MEAENAGSYSLQQAQAFYTFPFQQLMAEAPNMAVVNEQQMPEEVPAPAPAQEPVQEAPKGRKRKPRTTEPKQPVEPKKPVESKKSGKSAKSKEKQEKITDTFKVKRKVDRFNGVSEAELLTKTLPDILTFNLDIVIIGINPGLMAAYKGHHYPGPGNHFWKCLFMSGLSEVQLNHMDDHTLPGKYGIGFTNMVERTTPGSKDLSSKEFREGGRILVQKLQKYQPRIAVFNGKCIYEIFSKEVFGVKVKNLEFGLQPHKIPDTETLCYVMPSSSARCAQFPRAQDKVHYYIKLKDLRDQLKGIERNMDVQEVQYTFDLQLAQEDAKKMAVKEEKYDPGYEAAYGGAYGENPCSSEPCGFSSNGLIESVELRGESAFSGIPNGQWMTQSFTDQIPSFSNHCGTQEQEEESHA DIP protein Q13569 original sequence version: 70 DIP protein Q13569 original sequence version: 99 33752B26EBC789AE rnf4-apex1-1 1 5 unspecified role unspecified role bait bait N-terminal domain region 1-100 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human 4 unspecified role unspecified role prey prey human Homo sapiens Human 6 unspecified role unspecified role prey prey human Homo sapiens Human association association apex1-rnf4-1 2 5 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human 4 unspecified role unspecified role bait bait Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human physical association physical association tdg-rnf4-1 3 5 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human 6 unspecified role unspecified role bait bait Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human physical association physical association