DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Polycomb group targeting through different binding partners of RING1B C-terminal domain. Polycomb group targeting through different binding partners of RING1B C-terminal domain. Structure (London, England : 1993) 2010 imex curation Wang R., Taylor AB., Leal BZ., Chadwell LV., Ilangovan U., Robinson AK., Schirf V., Hart PJ., Lafer EM., Demeler B., Hinck AP., McEwen DG., Kim CA. Only protein-protein interactions ecolx Escherichia coli pull down pull down predetermined predetermined participant predetermined Wang R., Taylor AB., Leal BZ., Chadwell LV., Ilangovan U., Robinson AK., Schirf V., Hart PJ., Lafer EM., Demeler B., Hinck AP., McEwen DG., Kim CA. DIP original experiment: DIP-217146X Structure (London, England : 1993) 2010 IMEx Polycomb group targeting through different binding partners of RING1B C-terminal domain. Polycomb group targeting through different binding partners of RING1B C-terminal domain. Polycomb group targeting through different binding partners of RING1B C-terminal domain. Structure (London, England : 1993) 2010 imex curation Wang R., Taylor AB., Leal BZ., Chadwell LV., Ilangovan U., Robinson AK., Schirf V., Hart PJ., Lafer EM., Demeler B., Hinck AP., McEwen DG., Kim CA. Only protein-protein interactions ecolx Escherichia coli pull down pull down predetermined predetermined participant predetermined Wang R., Taylor AB., Leal BZ., Chadwell LV., Ilangovan U., Robinson AK., Schirf V., Hart PJ., Lafer EM., Demeler B., Hinck AP., McEwen DG., Kim CA. DIP original experiment: DIP-217150X Structure (London, England : 1993) 2010 IMEx Polycomb group targeting through different binding partners of RING1B C-terminal domain. Polycomb group targeting through different binding partners of RING1B C-terminal domain. Polycomb group targeting through different binding partners of RING1B C-terminal domain. Structure (London, England : 1993) 2010 imex curation Wang R., Taylor AB., Leal BZ., Chadwell LV., Ilangovan U., Robinson AK., Schirf V., Hart PJ., Lafer EM., Demeler B., Hinck AP., McEwen DG., Kim CA. Only protein-protein interactions in vitro In vitro comig non denat gel comigration in non denaturing gel electrophoresis comig non denat gel predetermined predetermined participant predetermined Wang R., Taylor AB., Leal BZ., Chadwell LV., Ilangovan U., Robinson AK., Schirf V., Hart PJ., Lafer EM., Demeler B., Hinck AP., McEwen DG., Kim CA. DIP original experiment: DIP-217158X Structure (London, England : 1993) 2010 IMEx Polycomb group targeting through different binding partners of RING1B C-terminal domain. Polycomb group targeting through different binding partners of RING1B C-terminal domain. Polycomb group targeting through different binding partners of RING1B C-terminal domain. Structure (London, England : 1993) 2010 imex curation Wang R., Taylor AB., Leal BZ., Chadwell LV., Ilangovan U., Robinson AK., Schirf V., Hart PJ., Lafer EM., Demeler B., Hinck AP., McEwen DG., Kim CA. Only protein-protein interactions ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Wang R., Taylor AB., Leal BZ., Chadwell LV., Ilangovan U., Robinson AK., Schirf V., Hart PJ., Lafer EM., Demeler B., Hinck AP., McEwen DG., Kim CA. DIP original experiment: DIP-217147X Structure (London, England : 1993) 2010 IMEx Polycomb group targeting through different binding partners of RING1B C-terminal domain. Polycomb group targeting through different binding partners of RING1B C-terminal domain. Polycomb group targeting through different binding partners of RING1B C-terminal domain. Structure (London, England : 1993) 2010 imex curation Wang R., Taylor AB., Leal BZ., Chadwell LV., Ilangovan U., Robinson AK., Schirf V., Hart PJ., Lafer EM., Demeler B., Hinck AP., McEwen DG., Kim CA. Only protein-protein interactions in vitro In vitro comig non denat gel comigration in non denaturing gel electrophoresis comig non denat gel predetermined predetermined participant predetermined Wang R., Taylor AB., Leal BZ., Chadwell LV., Ilangovan U., Robinson AK., Schirf V., Hart PJ., Lafer EM., Demeler B., Hinck AP., McEwen DG., Kim CA. DIP original experiment: DIP-217148X Structure (London, England : 1993) 2010 IMEx Polycomb group targeting through different binding partners of RING1B C-terminal domain. Polycomb group targeting through different binding partners of RING1B C-terminal domain. Polycomb group targeting through different binding partners of RING1B C-terminal domain. Structure (London, England : 1993) 2010 imex curation Wang R., Taylor AB., Leal BZ., Chadwell LV., Ilangovan U., Robinson AK., Schirf V., Hart PJ., Lafer EM., Demeler B., Hinck AP., McEwen DG., Kim CA. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Wang R., Taylor AB., Leal BZ., Chadwell LV., Ilangovan U., Robinson AK., Schirf V., Hart PJ., Lafer EM., Demeler B., Hinck AP., McEwen DG., Kim CA. DIP original experiment: DIP-217154X Structure (London, England : 1993) 2010 IMEx Polycomb group targeting through different binding partners of RING1B C-terminal domain. Polycomb group targeting through different binding partners of RING1B C-terminal domain. Polycomb group targeting through different binding partners of RING1B C-terminal domain. Structure (London, England : 1993) 2010 imex curation Wang R., Taylor AB., Leal BZ., Chadwell LV., Ilangovan U., Robinson AK., Schirf V., Hart PJ., Lafer EM., Demeler B., Hinck AP., McEwen DG., Kim CA. Only protein-protein interactions ecolx Escherichia coli pull down pull down predetermined predetermined participant predetermined Wang R., Taylor AB., Leal BZ., Chadwell LV., Ilangovan U., Robinson AK., Schirf V., Hart PJ., Lafer EM., Demeler B., Hinck AP., McEwen DG., Kim CA. DIP original experiment: DIP-217153X Structure (London, England : 1993) 2010 IMEx Polycomb group targeting through different binding partners of RING1B C-terminal domain. Polycomb group targeting through different binding partners of RING1B C-terminal domain. Polycomb group targeting through different binding partners of RING1B C-terminal domain. Structure (London, England : 1993) 2010 imex curation Wang R., Taylor AB., Leal BZ., Chadwell LV., Ilangovan U., Robinson AK., Schirf V., Hart PJ., Lafer EM., Demeler B., Hinck AP., McEwen DG., Kim CA. Only protein-protein interactions ecolx Escherichia coli nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Wang R., Taylor AB., Leal BZ., Chadwell LV., Ilangovan U., Robinson AK., Schirf V., Hart PJ., Lafer EM., Demeler B., Hinck AP., McEwen DG., Kim CA. DIP original experiment: DIP-217149X Structure (London, England : 1993) 2010 IMEx Polycomb group targeting through different binding partners of RING1B C-terminal domain. Polycomb group targeting through different binding partners of RING1B C-terminal domain. Polycomb group targeting through different binding partners of RING1B C-terminal domain. Structure (London, England : 1993) 2010 imex curation Wang R., Taylor AB., Leal BZ., Chadwell LV., Ilangovan U., Robinson AK., Schirf V., Hart PJ., Lafer EM., Demeler B., Hinck AP., McEwen DG., Kim CA. Only protein-protein interactions ecolx Escherichia coli ion exchange chrom ion exchange chromatography IEC IEC ion exchange chrom predetermined predetermined participant predetermined Wang R., Taylor AB., Leal BZ., Chadwell LV., Ilangovan U., Robinson AK., Schirf V., Hart PJ., Lafer EM., Demeler B., Hinck AP., McEwen DG., Kim CA. DIP original experiment: DIP-217145X Structure (London, England : 1993) 2010 IMEx Polycomb group targeting through different binding partners of RING1B C-terminal domain. Polycomb group targeting through different binding partners of RING1B C-terminal domain. Polycomb group targeting through different binding partners of RING1B C-terminal domain. Structure (London, England : 1993) 2010 imex curation Wang R., Taylor AB., Leal BZ., Chadwell LV., Ilangovan U., Robinson AK., Schirf V., Hart PJ., Lafer EM., Demeler B., Hinck AP., McEwen DG., Kim CA. Only protein-protein interactions ecolx Escherichia coli ion exchange chrom ion exchange chromatography IEC IEC ion exchange chrom predetermined predetermined participant predetermined Wang R., Taylor AB., Leal BZ., Chadwell LV., Ilangovan U., Robinson AK., Schirf V., Hart PJ., Lafer EM., Demeler B., Hinck AP., McEwen DG., Kim CA. DIP original experiment: DIP-217152X Structure (London, England : 1993) 2010 IMEx Polycomb group targeting through different binding partners of RING1B C-terminal domain. Polycomb group targeting through different binding partners of RING1B C-terminal domain. Polycomb group targeting through different binding partners of RING1B C-terminal domain. Structure (London, England : 1993) 2010 imex curation Wang R., Taylor AB., Leal BZ., Chadwell LV., Ilangovan U., Robinson AK., Schirf V., Hart PJ., Lafer EM., Demeler B., Hinck AP., McEwen DG., Kim CA. Only protein-protein interactions ecolx Escherichia coli pull down pull down predetermined predetermined participant predetermined Wang R., Taylor AB., Leal BZ., Chadwell LV., Ilangovan U., Robinson AK., Schirf V., Hart PJ., Lafer EM., Demeler B., Hinck AP., McEwen DG., Kim CA. DIP original experiment: DIP-217156X Structure (London, England : 1993) 2010 IMEx Polycomb group targeting through different binding partners of RING1B C-terminal domain. Polycomb group targeting through different binding partners of RING1B C-terminal domain. Polycomb group targeting through different binding partners of RING1B C-terminal domain. Structure (London, England : 1993) 2010 imex curation Wang R., Taylor AB., Leal BZ., Chadwell LV., Ilangovan U., Robinson AK., Schirf V., Hart PJ., Lafer EM., Demeler B., Hinck AP., McEwen DG., Kim CA. Only protein-protein interactions ecolx Escherichia coli solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Wang R., Taylor AB., Leal BZ., Chadwell LV., Ilangovan U., Robinson AK., Schirf V., Hart PJ., Lafer EM., Demeler B., Hinck AP., McEwen DG., Kim CA. DIP original experiment: DIP-217157X Structure (London, England : 1993) 2010 IMEx Polycomb group targeting through different binding partners of RING1B C-terminal domain. Polycomb group targeting through different binding partners of RING1B C-terminal domain. Polycomb group targeting through different binding partners of RING1B C-terminal domain. Structure (London, England : 1993) 2010 imex curation Wang R., Taylor AB., Leal BZ., Chadwell LV., Ilangovan U., Robinson AK., Schirf V., Hart PJ., Lafer EM., Demeler B., Hinck AP., McEwen DG., Kim CA. Only protein-protein interactions ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Wang R., Taylor AB., Leal BZ., Chadwell LV., Ilangovan U., Robinson AK., Schirf V., Hart PJ., Lafer EM., Demeler B., Hinck AP., McEwen DG., Kim CA. DIP original experiment: DIP-217151X Structure (London, England : 1993) 2010 IMEx Polycomb group targeting through different binding partners of RING1B C-terminal domain. Polycomb group targeting through different binding partners of RING1B C-terminal domain. Polycomb group targeting through different binding partners of RING1B C-terminal domain. Structure (London, England : 1993) 2010 imex curation Wang R., Taylor AB., Leal BZ., Chadwell LV., Ilangovan U., Robinson AK., Schirf V., Hart PJ., Lafer EM., Demeler B., Hinck AP., McEwen DG., Kim CA. Only protein-protein interactions in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Wang R., Taylor AB., Leal BZ., Chadwell LV., Ilangovan U., Robinson AK., Schirf V., Hart PJ., Lafer EM., Demeler B., Hinck AP., McEwen DG., Kim CA. DIP original experiment: DIP-217155X Structure (London, England : 1993) 2010 IMEx Polycomb group targeting through different binding partners of RING1B C-terminal domain. ring2_human E3 ubiquitin-protein ligase RING2 RING finger protein 2 RING finger protein 1B RING finger protein BAP-1 Protein DinG Huntingtin-interacting protein 2-interacting protein 3 RNF2 BAP1 DING HIPI3 RING1B RING-type E3 ubiquitin transferase RING2 protein protein human Homo sapiens Human MSQAVQTNGTQPLSKTWELSLYELQRTPQEAITDGLEIVVSPRSLHSELMCPICLDMLKNTMTTKECLHRFCADCIITALRSGNKECPTCRKKLVSKRSLRPDPNFDALISKIYPSRDEYEAHQERVLARINKHNNQQALSHSIEEGLKIQAMNRLQRGKKQQIENGSGAEDNGDSSHCSNASTHSNQEAGPSNKRTKTSDDSGLELDNNNAAMAIDPVMDGASEIELVFRPHPTLMEKDDSAQTRYIKTSGNATVDHLSKYLAVRLALEELRSKGESNQMNLDTASEKQYTIYIATASGQFTVLNGSFSLELVSEKYWKVNKPMELYYAPTKEHK DIP protein Q99496 original sequence version: 95 DIP protein Q99496 original sequence version: 94 DIP protein Q99496 original sequence version: 96 DIP protein Q99496 original sequence version: 125 DIP protein Q99496 original sequence version: 142 DIP protein Q99496 original sequence version: 159 DIP protein Q99496 original sequence version: 129 DIP protein Q99496 original sequence version: 99 DIP protein Q99496 original sequence version: 118 90EA546E1F4DB7EC cbx7_human Chromobox protein homolog 7 CBX7 protein protein human Homo sapiens Human MELSAIGEQVFAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPEEHILDPRLVMAYEEKEERDRASGYRKRGPKPKRLLLQRLYSMDLRSSHKAKGKEKLCFSLTCPLGSGSPEGVVKAGAPELVDKGPLVPTLPFPLRKPRKAHKYLRLSRKKFPPRGPNLESHSHRRELFLQEPPAPDVLQAAGEWEPAAQPPEEEADADLAEGPPPWTPALPSSEVTVTDITANSITVTFREAQAAEGFFRDRSGKF DIP protein O95931 original sequence version: 81 DIP protein O95931 original sequence version: 82 DIP protein O95931 original sequence version: 108 A90019C1D08812B8 q8iy57-1 YY1-associated factor 2 YAF2 protein protein human Homo sapiens Human MGDKKSPTRPKRQPKPSSDEGYWDCSVCTFRNSAEAFKCMMCDVRKGTSTRKPRPVSQLVAQQVTQQFVPPTQSKKEKKDKVEKEKSEKETTSKKNSHKKTRPRLKNVDRSSAQHLEVTVGDLTVIITDFKEKTKSPPASSAASADQHSQSGSSSDNTERGMSRSSSPRGEASSLNGESH DIP protein Q8IY57-1 original sequence version: 77 DIP protein Q8IY57 original sequence version: 118 rybp_human RING1 and YY1-binding protein Death effector domain-associated factor YY1 and E4TF1-associated factor 1 Apoptin-associating protein 1 RYBP DEDAF YEAF1 protein protein human Homo sapiens Human MTMGDKKSPTRPKRQAKPAADEGFWDCSVCTFRNSAEAFKCSICDVRKGTSTRKPRINSQLVAQQVAQQYATPPPPKKEKKEKVEKQDKEKPEKDKEISPSVTKKNTNKKTKPKSDILKDPPSEANSIQSANATTKTSETNHTSRPRLKNVDRSTAQQLAVTVGNVTVIITDFKEKTRSSSTSSSTVTSSAGSEQQNQSSSGSESTDKGSSRSSTPKGDMSAVNDESF DIP protein Q8N488 original sequence version: 70 DIP protein Q8N488 original sequence version: 110 EB9593460A3F0F4C rybp-rnf2-3 7 18 unspecified role unspecified role bait bait cbox domain Region 145-179 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 15 unspecified role unspecified role prey prey C-terminal domain Region 223-333 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli physical association physical association rnf2-rybp-2 12 18 unspecified role unspecified role unspecified role unspecified role cbox domain Region 145-198 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 15 unspecified role unspecified role unspecified role unspecified role C-terminal domain Region 222-336 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction cbx7-rnf2-4 9 16 unspecified role unspecified role unspecified role unspecified role cbox domain Region 219-248 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 15 unspecified role unspecified role unspecified role unspecified role C-terminal domain Region 223-333 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction cbx7-rnf2-5 8 16 unspecified role unspecified role unspecified role unspecified role cbox domain Region 211-251 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 15 unspecified role unspecified role unspecified role unspecified role C-terminal domain Region 222-336 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction rnf2-yaf2-1 3 17 unspecified role unspecified role unspecified role unspecified role cbox domain Region 103-150 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 15 unspecified role unspecified role unspecified role unspecified role C-terminal domain Region 222-336 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Q99496:p.Tyr262Ala Y262A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Y A This feature has been corrected as a result of our quality control procedures. The original label was 'Y262A'. Wed May 02 19:34:06 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr262ala' Tue Jun 30 18:37:54 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr262Ala' Q99496:p.His258Ala H258A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain H A This feature has been corrected as a result of our quality control procedures. The original label was 'H258A'. Wed May 02 20:05:37 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'his258ala' Tue Jun 30 16:06:26 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.His258Ala' ecolx Escherichia coli direct interaction direct interaction cbx7-rnf2-6 1 16 unspecified role unspecified role bait bait cbox domain Region 219-248 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 15 unspecified role unspecified role prey prey C-terminal domain Region 223-333 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli physical association physical association cbx7-rnf2-7 2 16 unspecified role unspecified role bait bait cbox domain Region 211-251 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecolx Escherichia coli 15 unspecified role unspecified role prey prey C-terminal domain Region 222-336 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli physical association physical association rnf2-rybp-3 6 18 unspecified role unspecified role prey prey cbox domain Region 145-179 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 15 unspecified role unspecified role bait bait C-terminal domain Region 222-336 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction rnf2-rybp-4 14 18 unspecified role unspecified role unspecified role unspecified role cbox domain Region 145-179 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 15 unspecified role unspecified role unspecified role unspecified role C-terminal domain Region 222-336 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction cbx7-rnf2-8 4 16 unspecified role unspecified role unspecified role unspecified role cbox domain Region 219-248 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 15 unspecified role unspecified role unspecified role unspecified role C-terminal domain Region 223-333 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction rnf2-rybp-5 13 18 unspecified role unspecified role unspecified role unspecified role cbox domain Region 145-179 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 15 unspecified role unspecified role unspecified role unspecified role C-terminal domain Region 223-333 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction rybp-rnf2-4 11 18 unspecified role unspecified role bait bait cbox domain Region 145-198 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecolx Escherichia coli 15 unspecified role unspecified role prey prey C-terminal domain Region 222-336 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli physical association physical association cbx7-rnf2-9 5 16 unspecified role unspecified role unspecified role unspecified role cbox domain Region 211-251 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain O95931:p.Phe234Asp F234D mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain F D This feature has been corrected as a result of our quality control procedures. The original label was 'F234D'. Wed May 02 14:38:58 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe234asp' Tue Jun 30 17:54:50 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe234Asp' ecolx Escherichia coli 15 unspecified role unspecified role unspecified role unspecified role C-terminal domain Region 222-336 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction rnf2-rybp-6 10 18 unspecified role unspecified role unspecified role unspecified role cbox domain Region 145-179 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 15 unspecified role unspecified role unspecified role unspecified role C-terminal domain Region 223-333 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction