DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Human origin recognition complex is essential for HP1 binding to chromatin and heterochromatin organization. Human origin recognition complex is essential for HP1 binding to chromatin and heterochromatin organization. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Prasanth SG., Shen Z., Prasanth KV., Stillman B. Only protein-protein interactions in vitro In vitro pull down pull down autoradiography autoradiography Prasanth SG., Shen Z., Prasanth KV., Stillman B. DIP original experiment: DIP-219935X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Human origin recognition complex is essential for HP1 binding to chromatin and heterochromatin organization. Human origin recognition complex is essential for HP1 binding to chromatin and heterochromatin organization. Human origin recognition complex is essential for HP1 binding to chromatin and heterochromatin organization. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Prasanth SG., Shen Z., Prasanth KV., Stillman B. Only protein-protein interactions in vitro In vitro pull down pull down autoradiography autoradiography Prasanth SG., Shen Z., Prasanth KV., Stillman B. DIP original experiment: DIP-219934X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Human origin recognition complex is essential for HP1 binding to chromatin and heterochromatin organization. orc1_human Origin recognition complex subunit 1 ORC1 ORC1L PARC1 Replication control protein 1 protein protein human Homo sapiens Human MAHYPTRLKTRKTYSWVGRPLLDRKLHYQTYREMCVKTEGCSTEIHIQIGQFVLIEGDDDENPYVAKLLELFEDDSDPPPKKRARVQWFVRFCEVPACKRHLLGRKPGAQEIFWYDYPACDSNINAETIIGLVRVIPLAPKDVVPTNLKNEKTLFVKLSWNEKKFRPLSSELFAELNKPQESAAKCQKPVRAKSKSAESPSWTPAEHVAKRIESRHSASKSRQTPTHPLTPRARKRLELGNLGNPQMSQQTSCASLDSPGRIKRKVAFSEITSPSKRSQPDKLQTLSPALKAPEKTRETGLSYTEDDKKASPEHRIILRTRIAASKTIDIREERTLTPISGGQRSSVVPSVILKPENIKKRDAKEAKAQNEATSTPHRIRRKSSVLTMNRIRQQLRFLGNSKSDQEEKEILPAAEISDSSSDEEEASTPPLPRRAPRTVSRNLRSSLKSSLHTLTKVPKKSLKPRTPRCAAPQIRSRSLAAQEPASVLEEARLRLHVSAVPESLPCREQEFQDIYNFVESKLLDHTGGCMYISGVPGTGKTATVHEVIRCLQQAAQANDVPPFQYIEVNGMKLTEPHQVYVQILQKLTGQKATANHAAELLAKQFCTRGSPQETTVLLVDELDLLWTHKQDIMYNLFDWPTHKEARLVVLAIANTMDLPERIMMNRVSSRLGLTRMCFQPYTYSQLQQILRSRLKHLKAFEDDAIQLVARKVAALSGDARRCLDICRRATEICEFSQQKPDSPGLVTIAHSMEAVDEMFSSSYITAIKNSSVLEQSFLRAILAEFRRSGLEEATFQQIYSQHVALCRMEGLPYPTMSETMAVCSHLGSCRLLLVEPSRNDLLLRVRLNVSQDDVLYALKDE DIP protein Q13415 original sequence version: 131 DIP protein Q13415 original sequence version: 64 DIP protein Q13415 original sequence version: 100 DIP protein Q13415 original sequence version: 105 5C594553F7F808E2 cbx5_human Chromobox protein homolog 5 CBX5 Heterochromatin protein 1 homolog alpha Antigen p25 HP1A protein protein human Homo sapiens Human MGKKTKRTADSSSSEDEEEYVVEKVLDRRVVKGQVEYLLKWKGFSEEHNTWEPEKNLDCPELISEFMKKYKKMKEGENNKPREKSESNKRKSNFSNSADDIKSKKKREQSNDIARGFERGLEPEKIIGATDSCGDLMFLMKWKDTDEADLVLAKEANVKCPQIVIAFYEERLTWHAYPEDAENKEKETAKS DIP protein P45973 original sequence version: 138 DIP protein P45973 original sequence version: 116 DIP protein P45973 original sequence version: 115 DIP protein P45973 original sequence version: 124 DIP protein P45973 original sequence version: 154 DIP protein P45973 original sequence version: 132 DIP protein P45973 original sequence version: 155 16FFC476367093B1 orc3_human Origin recognition complex subunit 3 ORC3 LATHEO Origin recognition complex subunit Latheo ORC3L protein protein human Homo sapiens Human MATSSMSKGCFVFKPNSKKRKISLPIEDYFNKGKNEPEDSKLRFETYQLIWQQMKSENERLQEELNKNLFDNLIEFLQKSHSGFQKNSRDLGGQIKLREIPTAALVLGVNVTDHDLTFGSLTEALQNNVTPYVVSLQAKDCPDMKHFLQKLISQLMDCCVDIKSKEEESVHVTQRKTHYSMDSLSSWYMTVTQKTDPKMLSKKRTTSSQWQSPPVVVILKDMESFATKVLQDFIIISSQHLHEFPLILIFGIATSPIIIHRLLPHAVSSLLCIELFQSLSCKEHLTTVLDKLLLTTQFPFKINEKVLQVLTNIFLYHDFSVQNFIKGLQLSLLEHFYSQPLSVLCCNLPEAKRRINFLSNNQCENIRRLPSFRRYVEKQASEKQVALLTNERYLKEETQLLLENLHVYHMNYFLVLRCLHKFTSSLPKYPLGRQIRELYCTCLEKNIWDSEEYASVLQLLRMLAKDELMTILEKCFKVFKSYCENHLGSTAKRIEEFLAQFQSLDETKEEEDASGSQPKGLQKTDLYHLQKSLLEMKELRRSKKQTKFEVLRENVVNFIDCLVREYLLPPETQPLHEVVYFSAAHALREHLNAAPRIALHTALNNPYYYLKNEALKSEEGCIPNIAPDICIAYKLHLECSRLINLVDWSEAFATVVTAAEKMDANSATSEEMNEIIHARFIRAVSELELLGFIKPTKQKTDHVARLTWGGC DIP protein Q9UBD5 original sequence version: 124 DIP protein Q9UBD5-1 original sequence version: 96 DIP protein Q9UBD5 original sequence version: 100 E713569A11B39B1C cbx5-orc1-1 2 3 unspecified role unspecified role prey prey 35S-label 35S-label 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 4 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli direct interaction direct interaction cbx5-orc3-1 1 5 unspecified role unspecified role prey prey 35S-label 35S-label 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Region 15-90 Region 15-90 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Region 197-711 Region 197-711 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain p.[Leu61Glu;Leu65Asp;Pro213_Ile218del] delta213-218/L61D/L65E mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L D certain certain sequence position certain certain certain sequence position certain L E certain certain sequence position certain certain certain sequence position certain PPVVVI . 4 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli direct interaction direct interaction