DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Intermolecular associations determine the dynamics of the circadian KaiABC oscillator. Intermolecular associations determine the dynamics of the circadian KaiABC oscillator. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Qin X., Byrne M., Mori T., Zou P., Williams DR., McHaourab H., Johnson CH. Only protein-protein interactions in vitro In vitro fluorescence spectr classical fluorescence spectroscopy fluorescence spectr predetermined predetermined participant predetermined Qin X., Byrne M., Mori T., Zou P., Williams DR., McHaourab H., Johnson CH. DIP original experiment: DIP-221276X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Intermolecular associations determine the dynamics of the circadian KaiABC oscillator. Intermolecular associations determine the dynamics of the circadian KaiABC oscillator. Intermolecular associations determine the dynamics of the circadian KaiABC oscillator. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Qin X., Byrne M., Mori T., Zou P., Williams DR., McHaourab H., Johnson CH. Only protein-protein interactions in vitro In vitro comig non denat gel comigration in non denaturing gel electrophoresis comig non denat gel predetermined predetermined participant predetermined Qin X., Byrne M., Mori T., Zou P., Williams DR., McHaourab H., Johnson CH. DIP original experiment: DIP-221279X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Intermolecular associations determine the dynamics of the circadian KaiABC oscillator. Intermolecular associations determine the dynamics of the circadian KaiABC oscillator. Intermolecular associations determine the dynamics of the circadian KaiABC oscillator. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Qin X., Byrne M., Mori T., Zou P., Williams DR., McHaourab H., Johnson CH. Only protein-protein interactions in vitro In vitro comig non denat gel comigration in non denaturing gel electrophoresis comig non denat gel predetermined predetermined participant predetermined Qin X., Byrne M., Mori T., Zou P., Williams DR., McHaourab H., Johnson CH. DIP original experiment: DIP-221278X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Intermolecular associations determine the dynamics of the circadian KaiABC oscillator. Intermolecular associations determine the dynamics of the circadian KaiABC oscillator. Intermolecular associations determine the dynamics of the circadian KaiABC oscillator. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Qin X., Byrne M., Mori T., Zou P., Williams DR., McHaourab H., Johnson CH. Only protein-protein interactions ecolx Escherichia coli comig non denat gel comigration in non denaturing gel electrophoresis comig non denat gel weight by comassie molecular weight estimation by coomasie staining weight by comassie Qin X., Byrne M., Mori T., Zou P., Williams DR., McHaourab H., Johnson CH. DIP original experiment: DIP-221280X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Intermolecular associations determine the dynamics of the circadian KaiABC oscillator. Intermolecular associations determine the dynamics of the circadian KaiABC oscillator. Intermolecular associations determine the dynamics of the circadian KaiABC oscillator. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Qin X., Byrne M., Mori T., Zou P., Williams DR., McHaourab H., Johnson CH. Only protein-protein interactions ecolx Escherichia coli comig non denat gel comigration in non denaturing gel electrophoresis comig non denat gel weight by comassie molecular weight estimation by coomasie staining weight by comassie Qin X., Byrne M., Mori T., Zou P., Williams DR., McHaourab H., Johnson CH. DIP original experiment: DIP-221277X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Intermolecular associations determine the dynamics of the circadian KaiABC oscillator. Intermolecular associations determine the dynamics of the circadian KaiABC oscillator. Intermolecular associations determine the dynamics of the circadian KaiABC oscillator. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Qin X., Byrne M., Mori T., Zou P., Williams DR., McHaourab H., Johnson CH. Only protein-protein interactions in vitro In vitro tem transmission electron microscopy tem predetermined predetermined participant predetermined Qin X., Byrne M., Mori T., Zou P., Williams DR., McHaourab H., Johnson CH. DIP original experiment: DIP-221281X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Intermolecular associations determine the dynamics of the circadian KaiABC oscillator. kaib_syne7 Circadian clock protein KaiB kaiB see0010 Synpcc7942_1217 protein protein syne7 Synechococcus elongatus (strain PCC 7942) Anacystis nidulans R2 MSPRKTYILKLYVAGNTPNSVRALKTLKNILEVEFQGVYALKVIDVLKNPQLAEEDKILATPTLAKVLPLPVRRIIGDLSDREKVLIGLDLLYGELQDSDDF DIP protein Q79PF5 original sequence version: 53 DIP protein Q79PF5 original sequence version: 78 4E7FD086742A398F kaia_syne7 Circadian clock protein KaiA see0009 kaiA Synpcc7942_1218 protein protein syne7 Synechococcus elongatus (strain PCC 7942) Anacystis nidulans R2 MLSQIAICIWVESTAILQDCQRALSADRYQLQVCESGEMLLEYAQTHRDQIDCLILVAANPSFRAVVQQLCFEGVVVPAIVVGDRDSEDPDEPAKEQLYHSAELHLGIHQLEQLPYQVDAALAEFLRLAPVETMADHIMLMGANHDPELSSQQRDLAQRLQERLGYLGVYYKRDPDRFLRNLPAYESQKLHQAMQTSYREIVLSYFSPNSNLNQSIDNFVNMAFFADVPVTKVVEIHMELMDEFAKKLRVEGRSEDILLDYRLTLIDVIAHLCEMYRRSIPRET DIP protein Q79PF6 original sequence version: 52 DIP protein Q79PF6 original sequence version: 58 DIP protein Q79PF6 original sequence version: 81 7C4F3B79FFDF59A2 kaic_syne7 Circadian clock protein kinase KaiC see0011 kaiC Synpcc7942_1216 protein protein syne7 Synechococcus elongatus (strain PCC 7942) Anacystis nidulans R2 MTSAEMTSPNNNSEHQAIAKMRTMIEGFDDISHGGLPIGRSTLVSGTSGTGKTLFSIQFLYNGIIEFDEPGVFVTFEETPQDIIKNARSFGWDLAKLVDEGKLFILDASPDPEGQEVVGGFDLSALIERINYAIQKYRARRVSIDSVTSVFQQYDASSVVRRELFRLVARLKQIGATTVMTTERIEEYGPIARYGVEEFVSDNVVILRNVLEGERRRRTLEILKLRGTSHMKGEYPFTITDHGINIFPLGAMRLTQRSSNVRVSSGVVRLDEMCGGGFFKDSIILATGATGTGKTLLVSRFVENACANKERAILFAYEESRAQLLRNAYSWGMDFEEMERQNLLKIVCAYPESAGLEDHLQIIKSEINDFKPARIAIDSLSALARGVSNNAFRQFVIGVTGYAKQEEITGLFTNTSDQFMGAHSITDSHISTITDTIILLQYVEIRGEMSRAINVFKMRGSWHDKAIREFMISDKGPDIKDSFRNFERIISGSPTRITVDEKSELSRIVRGVQEKGPES DIP protein Q79PF4 original sequence version: 65 DIP protein Q79PF4 original sequence version: 71 DIP protein Q79PF4 original sequence version: 105 855DFE131EFFF3CF kaia-kaic-22 1 9 unspecified role unspecified role unspecified role unspecified role Q79PF4:p.[Ser431Glu;Thr432Glu] S431E/T432E mutation increasing strength mutation increasing interaction strength mutation increasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain T E certain certain sequence position certain certain certain sequence position certain S E This feature has been corrected as a result of our quality control procedures. The original label was 'S431E/T432E'. Wed May 02 19:32:12 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser431glu,thr432glu' Tue Jun 30 20:17:28 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ser431Glu;Thr432Glu]' Q79PF4:p.[Ser431Ala;Thr432Ala] S431A/T432A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain T A certain certain sequence position certain certain certain sequence position certain S A This feature has been corrected as a result of our quality control procedures. The original label was 'S431A/T432A'. Wed May 02 16:51:00 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser431ala,thr432ala' Tue Jun 30 17:35:07 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ser431Ala;Thr432Ala]' ecolx Escherichia coli 8 unspecified role unspecified role unspecified role unspecified role Fluorescein-label Fluorescein-label fluor-5-maleimide fluorescein-5-maleimide label fluor-5-maleimide undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli direct interaction direct interaction kaia-3 4 8 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction kaic-4 5 9 unspecified role unspecified role unspecified role unspecified role Region 1-489 Region 1-489 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction kaia-kaib-2 6 8 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 7 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 9 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association kaia-kaib-3 2 8 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 7 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 9 unspecified role unspecified role unspecified role unspecified role Q79PF4:p.Ser431Ala S431A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain S A This feature has been corrected as a result of our quality control procedures. The original label was 'S431A'. Wed May 02 16:48:20 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser431ala' Tue Jun 30 16:44:57 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser431Ala' Region 1-489 Region 1-489 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli physical association physical association kaib-kaic-11 3 7 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 9 unspecified role unspecified role unspecified role unspecified role Q79PF4:p.Ser431Ala S431A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain S A This feature has been corrected as a result of our quality control procedures. The original label was 'S431A'. Wed May 02 16:48:36 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser431ala' Tue Jun 30 17:48:24 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser431Ala' Q79PF4:p.[Ser431Ala;Thr432Ala] S431A/T432A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain T A certain certain sequence position certain certain certain sequence position certain S A This feature has been corrected as a result of our quality control procedures. The original label was 'S431A/T432A'. Wed May 02 15:15:48 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser431ala,thr432ala' Tue Jun 30 16:37:55 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ser431Ala;Thr432Ala]' Q79PF4:p.[Ser431Ala;Thr432Glu] S431A/T432E mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain T E certain certain sequence position certain certain certain sequence position certain S A This feature has been corrected as a result of our quality control procedures. The original label was 'S431A/T432E'. Wed May 02 17:03:41 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser431ala,thr432glu' Tue Jun 30 17:51:22 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ser431Ala;Thr432Glu]' Q79PF4:p.[Ser431Asp;Thr432Ala] S431D/T432A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain T A certain certain sequence position certain certain certain sequence position certain S D This feature has been corrected as a result of our quality control procedures. The original label was 'S431D/T432A'. Wed May 02 14:54:45 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser431asp,thr432ala' Tue Jun 30 20:15:48 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ser431Asp;Thr432Ala]' Region 1-489 Region 1-489 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction