DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Ribosomal protein L7Ae is a subunit of archaeal RNase P. Ribosomal protein L7Ae is a subunit of archaeal RNase P. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Cho IM., Lai LB., Susanti D., Mukhopadhyay B., Gopalan V. Only protein-protein interactions ecolx Escherichia coli ion exchange chrom ion exchange chromatography IEC IEC ion exchange chrom weight by staining molecular weight estimation by staining weight by staining Cho IM., Lai LB., Susanti D., Mukhopadhyay B., Gopalan V. DIP original experiment: DIP-219925X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Ribosomal protein L7Ae is a subunit of archaeal RNase P. Ribosomal protein L7Ae is a subunit of archaeal RNase P. Ribosomal protein L7Ae is a subunit of archaeal RNase P. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Cho IM., Lai LB., Susanti D., Mukhopadhyay B., Gopalan V. Only protein-protein interactions metmi Methanococcus maripaludis Methanococcus deltae pull down pull down western blot western blot Immuno blot Immuno blot Cho IM., Lai LB., Susanti D., Mukhopadhyay B., Gopalan V. DIP original experiment: DIP-219924X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Ribosomal protein L7Ae is a subunit of archaeal RNase P. rnp2_metmp Ribonuclease P protein component 2 rnp2 Pop5 MMP0878 protein protein metmp Methanococcus maripaludis (strain S2 / LL) MLKTLPPTLREKKRYVALEIIYEMELSQKDVISVVRNALLNYSGVLGCSRTNPWLIDYGHPYGILRISREEVDTLRSSLSLMGEHKKKPINIRIIGISNSVKHIREKFLHVPHEPYYKVIQKLKRKGPKK DIP protein P60780 original sequence version: 37 rnp3_metmp Ribonuclease P protein component 3 rnp3 Rpp30 MMP0430 protein protein metmp Methanococcus maripaludis (strain S2 / LL) MLEGIFDINHVFDEEGIKTLKRFGWDGSVAVQNHNEYSEEKINTAVEYGENCEFKVYSGVKISTKNQNEMEKAVKKYRNKVDILLVEGGDVKINRRVLEMNDVDILSTPELNRMDNGLDHILARLGSTNRVAVELNFGNLLKSKNYDRSKILWAFQRNLKLSKKYDTPVVISSGANDIYGIKAPGDLRGFLNTVADPLYSKKIIETTSKIIDYRLYLKNKNVLMPGLEIVEE DIP protein P60781 original sequence version: 40 rl7a_metmp 50S ribosomal protein L7Ae rpl7ae Ribonuclease P protein component Rpp38 Ribosomal protein L8e MMP0641 protein protein metmp Methanococcus maripaludis (strain S2 / LL) MAVYVKFEISQELEEKTAEVVANAEKIKKGANEVTKAVEKGIAKLVVIAQDVQPEEIVAHIPVICDEKGIAYSYSSTKEALGKAAGLEVPTSAIAVVAEGSADELKDLVEKLNGLKA DIP protein P62426 original sequence version: 44 rnp3-rpl7ae-1 2 5 unspecified role unspecified role prey prey metmi Methanococcus maripaludis Methanococcus deltae 4 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range metmi Methanococcus maripaludis Methanococcus deltae physical association physical association rnp2-rnp3-1 1 3 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 4 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction