DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu HtrA proteases have a conserved activation mechanism that can be triggered by distinct molecular cues. HtrA proteases have a conserved activation mechanism that can be triggered by distinct molecular cues. Nature structural & molecular biology 2010 imex curation Krojer T., Sawa J., Huber R., Clausen T. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Krojer T., Sawa J., Huber R., Clausen T. DIP original experiment: DIP-218328X Nature structural & molecular biology 2010 IMEx HtrA proteases have a conserved activation mechanism that can be triggered by distinct molecular cues. HtrA proteases have a conserved activation mechanism that can be triggered by distinct molecular cues. HtrA proteases have a conserved activation mechanism that can be triggered by distinct molecular cues. Nature structural & molecular biology 2010 imex curation Krojer T., Sawa J., Huber R., Clausen T. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Krojer T., Sawa J., Huber R., Clausen T. DIP original experiment: DIP-218326X Nature structural & molecular biology 2010 IMEx HtrA proteases have a conserved activation mechanism that can be triggered by distinct molecular cues. HtrA proteases have a conserved activation mechanism that can be triggered by distinct molecular cues. HtrA proteases have a conserved activation mechanism that can be triggered by distinct molecular cues. Nature structural & molecular biology 2010 imex curation Krojer T., Sawa J., Huber R., Clausen T. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Krojer T., Sawa J., Huber R., Clausen T. DIP original experiment: DIP-218324X Nature structural & molecular biology 2010 IMEx HtrA proteases have a conserved activation mechanism that can be triggered by distinct molecular cues. HtrA proteases have a conserved activation mechanism that can be triggered by distinct molecular cues. HtrA proteases have a conserved activation mechanism that can be triggered by distinct molecular cues. Nature structural & molecular biology 2010 imex curation Krojer T., Sawa J., Huber R., Clausen T. Only protein-protein interactions in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Krojer T., Sawa J., Huber R., Clausen T. DIP original experiment: DIP-218327X Nature structural & molecular biology 2010 IMEx HtrA proteases have a conserved activation mechanism that can be triggered by distinct molecular cues. HtrA proteases have a conserved activation mechanism that can be triggered by distinct molecular cues. HtrA proteases have a conserved activation mechanism that can be triggered by distinct molecular cues. Nature structural & molecular biology 2010 imex curation Krojer T., Sawa J., Huber R., Clausen T. Only protein-protein interactions ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Krojer T., Sawa J., Huber R., Clausen T. DIP original experiment: DIP-218325X Nature structural & molecular biology 2010 IMEx HtrA proteases have a conserved activation mechanism that can be triggered by distinct molecular cues. HtrA proteases have a conserved activation mechanism that can be triggered by distinct molecular cues. HtrA proteases have a conserved activation mechanism that can be triggered by distinct molecular cues. Nature structural & molecular biology 2010 imex curation Krojer T., Sawa J., Huber R., Clausen T. Only protein-protein interactions in vitro In vitro protease assay protease assay weight by comassie molecular weight estimation by coomasie staining weight by comassie Krojer T., Sawa J., Huber R., Clausen T. DIP original experiment: DIP-218329X Nature structural & molecular biology 2010 IMEx HtrA proteases have a conserved activation mechanism that can be triggered by distinct molecular cues. degp_ecoli Periplasmic serine endoprotease DegP degP htrA ptd b0161 JW0157 Heat shock protein DegP Protease Do protein protein ecoli Escherichia coli (strain K12) MKKTTLALSALALSLGLALSPLSATAAETSSATTAQQMPSLAPMLEKVMPSVVSINVEGSTTVNTPRMPRNFQQFFGDDSPFCQEGSPFQSSPFCQGGQGGNGGGQQQKFMALGSGVIIDADKGYVVTNNHVVDNATVIKVQLSDGRKFDAKMVGKDPRSDIALIQIQNPKNLTAIKMADSDALRVGDYTVAIGNPFGLGETVTSGIVSALGRSGLNAENYENFIQTDAAINRGNSGGALVNLNGELIGINTAILAPDGGNIGIGFAIPSNMVKNLTSQMVEYGQVKRGELGIMGTELNSELAKAMKVDAQRGAFVSQVLPNSSAAKAGIKAGDVITSLNGKPISSFAALRAQVGTMPVGSKLTLGLLRDGKQVNVNLELQQSSQNQVDSSSIFNGIEGAEMSNKGKDQGVVVNNVKTGTPAAQIGLKKGDVIIGANQQAVKNIAELRKVLDSKPSVLALNIQRGDSTIYLLMQ DIP protein P0C0V0 original sequence version: 94 DIP protein P0C0V0 original sequence version: 75 DIP protein P0C0V0 original sequence version: 62 DIP protein P0C0V0 original sequence version: 84 DIP protein P0C0V0 original sequence version: 67 5482E596F74B6D5F yqv YQV peptide peptide peptide polypeptide oligopeptide oligopeptide polypeptide chemical synthesis Chemical synthesis (Chemical synthesis) SPMFKGVLDMMYGGMRGYQV casb_bovin Beta-casein CSN2 protein protein bovin Bos taurus (Bovine) Bovine MKVLILACLVALALARELEELNVPGEIVESLSSSEESITRINKKIEKFQSEEQQQTEDELQDKIHPFAQTQSLVYPFPGPIPNSLPQNIPPLTQTPVVVPPFLQPEVMGVSKVKEAMAPKHKEMPFPKYPVEPFTESQSLTLTDVENLHLPLPLLQSWMHQPHQPLPPTVMFPPQSVLSLSQSKVLPVPQKAVPYPQRDMPIQAFLLYQEPVLGPVRGPFPIIV DIP protein P02666 original sequence version: 88 DIP protein P02666 original sequence version: 101 F0BBDD8148A238AE degp-9 3 7 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction degp-yqv-1 4 8 unspecified role unspecified role unspecified role unspecified role in vitro In vitro 7 unspecified role unspecified role unspecified role unspecified role P0C0V0:p.Leu291Trp L291W mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L W This feature has been corrected as a result of our quality control procedures. The original label was 'L291W'. Wed May 02 18:30:36 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu291trp' Tue Jun 30 19:28:37 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu291Trp' ecolx Escherichia coli direct interaction direct interaction degp-10 5 7 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction csn2-degp-4 1 9 unspecified role unspecified role unspecified role unspecified role bovin Bos taurus (Bovine) Bovine 7 unspecified role unspecified role unspecified role unspecified role P0C0V0:p.Leu291Trp L291W mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L W This feature has been corrected as a result of our quality control procedures. The original label was 'L291W'. Wed May 02 15:22:55 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu291trp' Tue Jun 30 18:36:41 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu291Trp' P0C0V0:p.[Arg351Ala;Gln353Ala] R351A/Q353A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Q A certain certain sequence position certain certain certain sequence position certain R A This feature has been corrected as a result of our quality control procedures. The original label was 'R351A/Q353A'. Wed May 02 16:34:33 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg351ala,gln353ala' Tue Jun 30 19:49:28 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Arg351Ala;Gln353Ala]' ecolx Escherichia coli direct interaction direct interaction degp-yqv-2 2 8 unspecified role unspecified role unspecified role unspecified role in vitro In vitro 7 unspecified role unspecified role unspecified role unspecified role P0C0V0:p.Leu291Trp L291W mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L W This feature has been corrected as a result of our quality control procedures. The original label was 'L291W'. Wed May 02 16:21:57 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu291trp' Tue Jun 30 17:49:34 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu291Trp' ecolx Escherichia coli direct interaction direct interaction csn2-degp-5 6 9 enzyme target enzyme target substrate substrate unspecified role unspecified role bovin Bos taurus (Bovine) Bovine 7 enzyme enzyme unspecified role unspecified role P0C0V0:p.Leu291Trp L291W mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L W This feature has been corrected as a result of our quality control procedures. The original label was 'L291W'. Wed May 02 18:44:09 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu291trp' Tue Jun 30 16:52:15 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu291Trp' P0C0V0:p.Arg213Ala R213A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain R A This feature has been corrected as a result of our quality control procedures. The original label was 'R213A'. Wed May 02 17:51:46 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg213ala' Tue Jun 30 20:21:10 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg213Ala' P0C0V0:p.[Arg351Ala;Gln353Ala] R351A/Q353A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain R A certain certain sequence position certain certain certain sequence position certain Q A This feature has been corrected as a result of our quality control procedures. The original label was 'R351A/Q353A'. Wed May 02 16:48:31 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg351ala,gln353ala' Tue Jun 30 17:56:29 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Arg351Ala;Gln353Ala]' ecolx Escherichia coli protein cleavage protein cleavage