DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Structural and functional analysis of the interaction between the nucleoporin Nup98 and the mRNA export factor Rae1. Structural and functional analysis of the interaction between the nucleoporin Nup98 and the mRNA export factor Rae1. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Ren Y., Seo HS., Blobel G., Hoelz A. Only protein-protein interactions spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Ren Y., Seo HS., Blobel G., Hoelz A. DIP original experiment: DIP-219816X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Structural and functional analysis of the interaction between the nucleoporin Nup98 and the mRNA export factor Rae1. Structural and functional analysis of the interaction between the nucleoporin Nup98 and the mRNA export factor Rae1. Structural and functional analysis of the interaction between the nucleoporin Nup98 and the mRNA export factor Rae1. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Ren Y., Seo HS., Blobel G., Hoelz A. Only protein-protein interactions spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Ren Y., Seo HS., Blobel G., Hoelz A. DIP original experiment: DIP-219818X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Structural and functional analysis of the interaction between the nucleoporin Nup98 and the mRNA export factor Rae1. Structural and functional analysis of the interaction between the nucleoporin Nup98 and the mRNA export factor Rae1. Structural and functional analysis of the interaction between the nucleoporin Nup98 and the mRNA export factor Rae1. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Ren Y., Seo HS., Blobel G., Hoelz A. Only protein-protein interactions spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm pull down pull down predetermined predetermined participant predetermined Ren Y., Seo HS., Blobel G., Hoelz A. DIP original experiment: DIP-219815X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Structural and functional analysis of the interaction between the nucleoporin Nup98 and the mRNA export factor Rae1. Structural and functional analysis of the interaction between the nucleoporin Nup98 and the mRNA export factor Rae1. Structural and functional analysis of the interaction between the nucleoporin Nup98 and the mRNA export factor Rae1. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Ren Y., Seo HS., Blobel G., Hoelz A. Only protein-protein interactions spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Ren Y., Seo HS., Blobel G., Hoelz A. DIP original experiment: DIP-219817X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Structural and functional analysis of the interaction between the nucleoporin Nup98 and the mRNA export factor Rae1. Structural and functional analysis of the interaction between the nucleoporin Nup98 and the mRNA export factor Rae1. Structural and functional analysis of the interaction between the nucleoporin Nup98 and the mRNA export factor Rae1. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Ren Y., Seo HS., Blobel G., Hoelz A. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Ren Y., Seo HS., Blobel G., Hoelz A. DIP original experiment: DIP-219819X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Structural and functional analysis of the interaction between the nucleoporin Nup98 and the mRNA export factor Rae1. nup98_human Nuclear pore complex protein Nup98-Nup96 NUP98 ADAR2 protein protein human Homo sapiens Human MFNKSFGTPFGGGTGGFGTTSTFGQNTGFGTTSGGAFGTSAFGSSNNTGGLFGNSQTKPGGLFGTSSFSQPATSTSTGFGFGTSTGTANTLFGTASTGTSLFSSQNNAFAQNKPTGFGNFGTSTSSGGLFGTTNTTSNPFGSTSGSLFGPSSFTAAPTGTTIKFNPPTGTDTMVKAGVSTNISTKHQCITAMKEYESKSLEELRLEDYQANRKGPQNQVGAGTTTGLFGSSPATSSATGLFSSSTTNSGFAYGQNKTAFGTSTTGFGTNPGGLFGQQNQQTTSLFSKPFGQATTTQNTGFSFGNTSTIGQPSTNTMGLFGVTQASQPGGLFGTATNTSTGTAFGTGTGLFGQTNTGFGAVGSTLFGNNKLTTFGSSTTSAPSFGTTSGGLFGNKPTLTLGTNTNTSNFGFGTNTSGNSIFGSKPAPGTLGTGLGAGFGTALGAGQASLFGNNQPKIGGPLGTGAFGAPGFNTTTATLGFGAPQAPVALTDPNASAAQQAVLQQHINSLTYSPFGDSPLFRNPMSDPKKKEERLKPTNPAAQKALTTPTHYKLTPRPATRVRPKALQTTGTAKSHLFDGLDDDEPSLANGAFMPKKSIKKLVLKNLNNSNLFSPVNRDSENLASPSEYPENGERFSFLSKPVDENHQQDGDEDSLVSHFYTNPIAKPIPQTPESAGNKHSNSNSVDDTIVALNMRAALRNGLEGSSEETSFHDESLQDDREEIENNSYHMHPAGIILTKVGYYTIPSMDDLAKITNEKGECIVSDFTIGRKGYGSIYFEGDVNLTNLNLDDIVHIRRKEVVVYLDDNQKPPVGEGLNRKAEVTLDGVWPTDKTSRCLIKSPDRLADINYEGRLEAVSRKQGAQFKEYRPETGSWVFKVSHFSKYGLQDSDEEEEEHPSKTSTKKLKTAPLPPASQTTPLQMALNGKPAPPPQSQSPEVEQLGRVVELDSDMVDITQEPVLDTMLEESMPEDQEPVSASTHIASSLGINPHVLQIMKASLLTDEEDVDMALDQRFSRLPSKADTSQEICSPRLPISASHSSKTRSLVGGLLQSKFTSGAFLSPSVSVQECRTPRAASLMNIPSTSSWSVPPPLTSVFTMPSPAPEVPLKTVGTRRQLGLVPREKSVTYGKGKLLMDMALFMGRSFRVGWGPNWTLANSGEQLNGSHELENHQIADSMEFGFLPNPVAVKPLTESPFKVHLEKLSLRQRKPDEDMKLYQTPLELKLKHSTVHVDELCPLIVPNLGVAVIHDYADWVKEASGDLPEAQIVKHWSLTWTLCEALWGHLKELDSQLNEPREYIQILERRRAFSRWLSCTATPQIEEEVSLTQKNSPVEAVFSYLTGKRISEACSLAQQSGDHRLALLLSQFVGSQSVRELLTMQLVDWHQLQADSFIQDERLRIFALLAGKPVWQLSEKKQINVCSQLDWKRSLAIHLWYLLPPTASISRALSMYEEAFQNTSDSDRYACSPLPSYLEGSGCVIAEEQNSQTPLRDVCFHLLKLYSDRHYDLNQLLEPRSITADPLDYRLSWHLWEVLRALNYTHLSAQCEGVLQASYAGQLESEGLWEWAIFVLLHIDNSGIREKAVRELLTRHCQLLETPESWAKETFLTQKLRVPAKWIHEAKAVRAHMESDKHLEALCLFKAEHWNRCHKLIIRHLASDAIINENYDYLKGFLEDLAPPERSSLIQDWETSGLVYLDYIRVIEMLRHIQQVDCSGNDLEQLHIKVTSLCSRIEQIQCYSAKDRLAQSDMAKRVANLLRVVLSLHHPPDRTSDSTPDPQRVPLRLLAPHIGRLPMPEDYAMDELRSLTQSYLRELAVGSL DIP protein P52948 original sequence version: 164 DIP protein P52948 original sequence version: 153 DIP protein P52948 original sequence version: 118 DIP protein P52948 original sequence version: 125 BC60E5456B936C79 rae1l_human mRNA export factor mRNA-associated protein mrnp 41 Rae1 protein homolog RAE1 MRNP41 protein protein human Homo sapiens Human MSLFGTTSGFGTSGTSMFGSATTDNHNPMKDIEVTSSPDDSIGCLSFSPPTLPGNFLIAGSWANDVRCWEVQDSGQTIPKAQQMHTGPVLDVCWSDDGSKVFTASCDKTAKMWDLSSNQAIQIAQHDAPVKTIHWIKAPNYSCVMTGSWDKTLKFWDTRSSNPMMVLQLPERCYCADVIYPMAVVATAERGLIVYQLENQPSEFRRIESPLKHQHRCVAIFKDKQNKPTGFALGSIEGRVAIHYINPPNPAKDNFTFKCHRSNGTNTSAPQDIYAVNGIAFHPVHGTLATVGSDGRFSFWDKDARTKLKTSEQLDQPISACCFNHNGNIFAYASSYDWSKGHEFYNPQKKNYIFLRNAAEELKPRNKK DIP protein P78406 original sequence version: 142 DIP protein P78406 original sequence version: 132 DIP protein P78406 original sequence version: 97 DIP protein P78406 original sequence version: 103 89A99C34BA668A97 rae1-nup98-2 3 7 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 6 unspecified role unspecified role prey prey GLEBS motif domain Region 157-213 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm physical association physical association nup98-rae1-1 4 7 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 6 unspecified role unspecified role unspecified role unspecified role GLEBS motif domain Region 157-213 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm direct interaction direct interaction nup98-rae1-2 2 7 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 6 unspecified role unspecified role unspecified role unspecified role GLEBS motif domain Region 157-213 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm direct interaction direct interaction nup98-rae1-3 1 7 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 6 unspecified role unspecified role unspecified role unspecified role GLEBS motif domain Region 157-213 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm direct interaction direct interaction nup98-rae1-4 5 7 unspecified role unspecified role prey prey spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 6 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range P52948:p.[Glu201Lys;Glu202Lys] E201K/E202K mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain E K certain certain sequence position certain certain certain sequence position certain E K This feature has been corrected as a result of our quality control procedures. The original label was 'E201K/E202K'. Wed May 02 20:12:10 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu201lys,glu202lys' Tue Jun 30 16:44:36 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Glu201Lys;Glu202Lys]' Region 179-213 Region 179-213 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction