DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Structural basis of UGUA recognition by the Nudix protein CFI(m)25 and implications for a regulatory role in mRNA 3' processing. Structural basis of UGUA recognition by the Nudix protein CFI(m)25 and implications for a regulatory role in mRNA 3' processing. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Yang Q., Gilmartin GM., Doublié S. Only protein-protein interactions ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Yang Q., Gilmartin GM., Doublié S. DIP original experiment: DIP-219795X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Structural basis of UGUA recognition by the Nudix protein CFI(m)25 and implications for a regulatory role in mRNA 3' processing. cpsf5_human Cleavage and polyadenylation specificity factor subunit 5 NUDT21 CFIM25 CPSF25 CPSF5 Cleavage and polyadenylation specificity factor 25 kDa subunit Nucleoside diphosphate-linked moiety X motif 21 Cleavage factor Im complex 25 kDa subunit Nudix hydrolase 21 Pre-mRNA cleavage factor Im 68 kDa subunit protein protein human Homo sapiens Human MSVVPPNRSQTGWPRGVTQFGNKYIQQTKPLTLERTINLYPLTNYTFGTKEPLYEKDSSVAARFQRMREEFDKIGMRRTVEGVLIVHEHRLPHVLLLQLGTTFFKLPGGELNPGEDEVEGLKRLMTEILGRQDGVLQDWVIDDCIGNWWRPNFEPPQYPYIPAHITKPKEHKKLFLVQLQEKALFAVPKNYKLVAAPLFELYDNAPGYGPIISSLPQLLSRFNFIYN DIP protein O43809 original sequence version: 95 D204243E57F1CCC5 nudt21-1 1 2 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction