DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Synaptic cell adhesion molecule SynCAM 1 is a target for polysialylation in postnatal mouse brain. Synaptic cell adhesion molecule SynCAM 1 is a target for polysialylation in postnatal mouse brain. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Galuska SP., Rollenhagen M., Kaup M., Eggers K., Oltmann-Norden I., Schiff M., Hartmann M., Weinhold B., Hildebrandt H., Geyer R., Mühlenhoff M., Geyer H. Only protein-protein interactions in vitro In vitro glycosylase assay glycosylase assay weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Galuska SP., Rollenhagen M., Kaup M., Eggers K., Oltmann-Norden I., Schiff M., Hartmann M., Weinhold B., Hildebrandt H., Geyer R., Mühlenhoff M., Geyer H. DIP original experiment: DIP-221055X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Synaptic cell adhesion molecule SynCAM 1 is a target for polysialylation in postnatal mouse brain. Synaptic cell adhesion molecule SynCAM 1 is a target for polysialylation in postnatal mouse brain. Synaptic cell adhesion molecule SynCAM 1 is a target for polysialylation in postnatal mouse brain. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Galuska SP., Rollenhagen M., Kaup M., Eggers K., Oltmann-Norden I., Schiff M., Hartmann M., Weinhold B., Hildebrandt H., Geyer R., Mühlenhoff M., Geyer H. Only protein-protein interactions in vitro In vitro glycosylase assay glycosylase assay weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Galuska SP., Rollenhagen M., Kaup M., Eggers K., Oltmann-Norden I., Schiff M., Hartmann M., Weinhold B., Hildebrandt H., Geyer R., Mühlenhoff M., Geyer H. DIP original experiment: DIP-221050X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Synaptic cell adhesion molecule SynCAM 1 is a target for polysialylation in postnatal mouse brain. Synaptic cell adhesion molecule SynCAM 1 is a target for polysialylation in postnatal mouse brain. Synaptic cell adhesion molecule SynCAM 1 is a target for polysialylation in postnatal mouse brain. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Galuska SP., Rollenhagen M., Kaup M., Eggers K., Oltmann-Norden I., Schiff M., Hartmann M., Weinhold B., Hildebrandt H., Geyer R., Mühlenhoff M., Geyer H. Only protein-protein interactions in vitro In vitro glycosylase assay glycosylase assay weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Galuska SP., Rollenhagen M., Kaup M., Eggers K., Oltmann-Norden I., Schiff M., Hartmann M., Weinhold B., Hildebrandt H., Geyer R., Mühlenhoff M., Geyer H. DIP original experiment: DIP-221052X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Synaptic cell adhesion molecule SynCAM 1 is a target for polysialylation in postnatal mouse brain. Synaptic cell adhesion molecule SynCAM 1 is a target for polysialylation in postnatal mouse brain. Synaptic cell adhesion molecule SynCAM 1 is a target for polysialylation in postnatal mouse brain. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Galuska SP., Rollenhagen M., Kaup M., Eggers K., Oltmann-Norden I., Schiff M., Hartmann M., Weinhold B., Hildebrandt H., Geyer R., Mühlenhoff M., Geyer H. Only protein-protein interactions in vitro In vitro glycosylase assay glycosylase assay weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Galuska SP., Rollenhagen M., Kaup M., Eggers K., Oltmann-Norden I., Schiff M., Hartmann M., Weinhold B., Hildebrandt H., Geyer R., Mühlenhoff M., Geyer H. DIP original experiment: DIP-221054X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Synaptic cell adhesion molecule SynCAM 1 is a target for polysialylation in postnatal mouse brain. Synaptic cell adhesion molecule SynCAM 1 is a target for polysialylation in postnatal mouse brain. Synaptic cell adhesion molecule SynCAM 1 is a target for polysialylation in postnatal mouse brain. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Galuska SP., Rollenhagen M., Kaup M., Eggers K., Oltmann-Norden I., Schiff M., Hartmann M., Weinhold B., Hildebrandt H., Geyer R., Mühlenhoff M., Geyer H. Only protein-protein interactions in vitro In vitro glycosylase assay glycosylase assay weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Galuska SP., Rollenhagen M., Kaup M., Eggers K., Oltmann-Norden I., Schiff M., Hartmann M., Weinhold B., Hildebrandt H., Geyer R., Mühlenhoff M., Geyer H. DIP original experiment: DIP-221053X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Synaptic cell adhesion molecule SynCAM 1 is a target for polysialylation in postnatal mouse brain. Synaptic cell adhesion molecule SynCAM 1 is a target for polysialylation in postnatal mouse brain. Synaptic cell adhesion molecule SynCAM 1 is a target for polysialylation in postnatal mouse brain. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Galuska SP., Rollenhagen M., Kaup M., Eggers K., Oltmann-Norden I., Schiff M., Hartmann M., Weinhold B., Hildebrandt H., Geyer R., Mühlenhoff M., Geyer H. Only protein-protein interactions in vitro In vitro glycosylase assay glycosylase assay weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Galuska SP., Rollenhagen M., Kaup M., Eggers K., Oltmann-Norden I., Schiff M., Hartmann M., Weinhold B., Hildebrandt H., Geyer R., Mühlenhoff M., Geyer H. DIP original experiment: DIP-221051X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Synaptic cell adhesion molecule SynCAM 1 is a target for polysialylation in postnatal mouse brain. sia8b_mouse Alpha-2,8-sialyltransferase 8B St8sia2 Siat8b Stx Polysialic acid synthase Sialyltransferase 8B Sialyltransferase St8Sia II Sialyltransferase X protein protein mouse Mus musculus Mouse MQLQFRSWMLAALTLLVVFLIFADISEIEEEIGNSGGRGTIRSAVNSLHSKSNRAEVVINGSSPPAVADRSNESLKHNIQPASSKWRHNQTLSLRIRKQILKFLDAEKDISVLKGTLKPGDIIHYIFDRDSTMNVSQNLYELLPRTSPLKNKHFQTCAIVGNSGVLLNSGCGQEIDTHSFVIRCNLAPVQEYARDVGLKTDLVTMNPSVIQRAFEDLVNATWREKLLQRLHGLNGSILWIPAFMARGGKERVEWVNALILKHHVNVRTAYPSLRLLHAVRGYWLTNKVHIKRPTTGLLMYTLATRFCNQIYLYGFWPFPLDQNQNPVKYHYYDSLKYGYTSQASPHTMPLEFKALKSLHEQGALKLTVGQCDGAT DIP protein O35696 original sequence version: 79 cadm1_human Cell adhesion molecule 1 CADM1 IGSF4 IGSF4A NECL2 SYNCAM TSLC1 Immunoglobulin superfamily member 4 Nectin-like protein 2 Spermatogenic immunoglobulin superfamily Synaptic cell adhesion molecule Tumor suppressor in lung cancer 1 protein protein human Homo sapiens Human MASVVLPSGSQCAAAAAAAAPPGLRLRLLLLLFSAAALIPTGDGQNLFTKDVTVIEGEVATISCQVNKSDDSVIQLLNPNRQTIYFRDFRPLKDSRFQLLNFSSSELKVSLTNVSISDEGRYFCQLYTDPPQESYTTITVLVPPRNLMIDIQKDTAVEGEEIEVNCTAMASKPATTIRWFKGNTELKGKSEVEEWSDMYTVTSQLMLKVHKEDDGVPVICQVEHPAVTGNLQTQRYLEVQYKPQVHIQMTYPLQGLTREGDALELTCEAIGKPQPVMVTWVRVDDEMPQHAVLSGPNLFINNLNKTDNGTYRCEASNIVGKAHSDYMLYVYDPPTTIPPPTTTTTTTTTTTTTILTIITDSRAGEEGSIRAVDHAVIGGVVAVVVFAMLCLLIILGRYFARHKGTYFTHEAKGADDAADADTAIINAEGGQNNSEEKKEYFI CDEDE1E0C08BDD3A CDEDE1E0C08BDD3A ncam1_human Neural cell adhesion molecule 1 NCAM1 NCAM protein protein human Homo sapiens Human MLQTKDLIWTLFFLGTAVSLQVDIVPSQGEISVGESKFFLCQVAGDAKDKDISWFSPNGEKLTPNQQRISVVWNDDSSSTLTIYNANIDDAGIYKCVVTGEDGSESEATVNVKIFQKLMFKNAPTPQEFREGEDAVIVCDVVSSLPPTIIWKHKGRDVILKKDVRFIVLSNNYLQIRGIKKTDEGTYRCEGRILARGEINFKDIQVIVNVPPTIQARQNIVNATANLGQSVTLVCDAEGFPEPTMSWTKDGEQIEQEEDDEKYIFSDDSSQLTIKKVDKNDEAEYICIAENKAGEQDATIHLKVFAKPKITYVENQTAMELEEQVTLTCEASGDPIPSITWRTSTRNISSEEKASWTRPEKQETLDGHMVVRSHARVSSLTLKSIQYTDAGEYICTASNTIGQDSQSMYLEVQYAPKLQGPVAVYTWEGNQVNITCEVFAYPSATISWFRDGQLLPSSNYSNIKIYNTPSASYLEVTPDSENDFGNYNCTAVNRIGQESLEFILVQADTPSSPSIDQVEPYSSTAQVQFDEPEATGGVPILKYKAEWRAVGEEVWHSKWYDAKEASMEGIVTIVGLKPETTYAVRLAALNGKGLGEISAASEFKTQPVQGEPSAPKLEGQMGEDGNSIKVNLIKQDDGGSPIRHYLVRYRALSSEWKPEIRLPSGSDHVMLKSLDWNAEYEVYVVAENQQGKSKAAHFVFRTSAQPTAIPANGSPTSGLSTGAIVGILIVIFVLLLVVVDITCYFLNKCGLFMCIAVNLCGKAGPGAKGKDMEEGKAAFSKDESKEPIVEVRTEEERTPNHDGGKHTEPNETTPLTEPEKGPVEAKPECQETETKPAPAEVKTVPNDATQTKENESKA DIP protein P13591 original sequence version: 136 FD3B9DE80D802554 sia8d_crigr CMP-N-acetylneuraminate-poly-alpha-2,8-sialyltransferase ST8SIA4 PST-1 PST1 SIAT8D Alpha-2,8-sialyltransferase 8D Polysialyltransferase-1 Sialyltransferase 8D Sialyltransferase St8Sia IV protein protein crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster MRSIRKRWTICTISLLLIFYKTKEIARTEEHQETQLIGDGELCLSRSLVNSSDKIIRKAGSTIFQHSVQGWRINSSLVLEIRKNILRFLDAERDVSVVKSSFKPGDVIHYVLDRRRTLNISHDLHSLLPEVSPMKNRRFKTCAVVGNSGILLDSGCGKEIDSHNFVIRCNLAPVVEFAADVGTKSDFITMNPSVVQRAFGGFRNESDRAKFVHRLSMLNDSVLWIPAFMVKGGEKHVEWVNALILKNKLKVRTAYPSLRLIHAVRGYWLTNKVPIKRPSTGLLMYTLATRFCDEIHLYGFWPFPKDLNGKAVKYHYYDDLKYRYFSNASPHRMPLEFKTLNVLHNRGALKLTTGKCMKQ DIP protein Q64690 original sequence version: 59 st8sia2-syncam1-1 3 8 enzyme target enzyme target substrate substrate unspecified role unspecified role Region 39-346 Region 39-346 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ProtA-tag ProtA-tag protein a tag protein a tag protein A protein A n-term range n-terminal range n-term range n-term range n-terminal range n-term range crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster 7 enzyme enzyme unspecified role unspecified role Region 57-375 Region 57-375 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm glycosylation glycosylation reaction glycosylation ncam1-st8sia2-1 2 9 enzyme target enzyme target substrate substrate unspecified role unspecified role ProtA-tag ProtA-tag protein a tag protein a tag protein A protein A n-term range n-terminal range n-term range n-term range n-terminal range n-term range crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster 7 enzyme enzyme unspecified role unspecified role Region 57-375 Region 57-375 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm glycosylation glycosylation reaction glycosylation st8sia4-syncam1-1 4 8 enzyme target enzyme target substrate substrate unspecified role unspecified role Region 39-346 Region 39-346 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ProtA-tag ProtA-tag protein a tag protein a tag protein A protein A n-term range n-terminal range n-term range n-term range n-terminal range n-term range crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster 10 enzyme enzyme unspecified role unspecified role Region 26-359 Region 26-359 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm glycosylation glycosylation reaction glycosylation ncam1-st8sia4-1 6 9 enzyme target enzyme target substrate substrate unspecified role unspecified role ProtA-tag ProtA-tag protein a tag protein a tag protein A protein A n-term range n-terminal range n-term range n-term range n-terminal range n-term range crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster 10 enzyme enzyme unspecified role unspecified role Region 26-359 Region 26-359 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm glycosylation glycosylation reaction glycosylation st8sia2-syncam1-2 5 8 enzyme target enzyme target substrate substrate unspecified role unspecified role Region 1-346 Region 1-346 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster 7 enzyme enzyme unspecified role unspecified role Region 57-375 Region 57-375 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm glycosylation glycosylation reaction glycosylation st8sia4-syncam1-2 1 8 enzyme target enzyme target substrate substrate unspecified role unspecified role Region 1-346 Region 1-346 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster 10 enzyme enzyme unspecified role unspecified role Region 26-359 Region 26-359 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm glycosylation glycosylation reaction glycosylation