DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Structure of Arabidopsis HYPONASTIC LEAVES1 and its molecular implications for miRNA processing. Structure of Arabidopsis HYPONASTIC LEAVES1 and its molecular implications for miRNA processing. Structure (London, England : 1993) 2010 imex curation Yang SW., Chen HY., Yang J., Machida S., Chua NH., Yuan YA. Only protein-protein interactions arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Yang SW., Chen HY., Yang J., Machida S., Chua NH., Yuan YA. DIP original experiment: DIP-216871X Structure (London, England : 1993) 2010 IMEx Structure of Arabidopsis HYPONASTIC LEAVES1 and its molecular implications for miRNA processing. Structure of Arabidopsis HYPONASTIC LEAVES1 and its molecular implications for miRNA processing. Structure of Arabidopsis HYPONASTIC LEAVES1 and its molecular implications for miRNA processing. Structure (London, England : 1993) 2010 imex curation Yang SW., Chen HY., Yang J., Machida S., Chua NH., Yuan YA. Only protein-protein interactions ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Yang SW., Chen HY., Yang J., Machida S., Chua NH., Yuan YA. DIP original experiment: DIP-216867X Structure (London, England : 1993) 2010 IMEx Structure of Arabidopsis HYPONASTIC LEAVES1 and its molecular implications for miRNA processing. Structure of Arabidopsis HYPONASTIC LEAVES1 and its molecular implications for miRNA processing. Structure of Arabidopsis HYPONASTIC LEAVES1 and its molecular implications for miRNA processing. Structure (London, England : 1993) 2010 imex curation Yang SW., Chen HY., Yang J., Machida S., Chua NH., Yuan YA. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Yang SW., Chen HY., Yang J., Machida S., Chua NH., Yuan YA. DIP original experiment: DIP-216869X Structure (London, England : 1993) 2010 IMEx Structure of Arabidopsis HYPONASTIC LEAVES1 and its molecular implications for miRNA processing. Structure of Arabidopsis HYPONASTIC LEAVES1 and its molecular implications for miRNA processing. Structure of Arabidopsis HYPONASTIC LEAVES1 and its molecular implications for miRNA processing. Structure (London, England : 1993) 2010 imex curation Yang SW., Chen HY., Yang J., Machida S., Chua NH., Yuan YA. Only protein-protein interactions arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Yang SW., Chen HY., Yang J., Machida S., Chua NH., Yuan YA. DIP original experiment: DIP-216870X Structure (London, England : 1993) 2010 IMEx Structure of Arabidopsis HYPONASTIC LEAVES1 and its molecular implications for miRNA processing. Structure of Arabidopsis HYPONASTIC LEAVES1 and its molecular implications for miRNA processing. Structure of Arabidopsis HYPONASTIC LEAVES1 and its molecular implications for miRNA processing. Structure (London, England : 1993) 2010 imex curation Yang SW., Chen HY., Yang J., Machida S., Chua NH., Yuan YA. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Yang SW., Chen HY., Yang J., Machida S., Chua NH., Yuan YA. DIP original experiment: DIP-216868X Structure (London, England : 1993) 2010 IMEx Structure of Arabidopsis HYPONASTIC LEAVES1 and its molecular implications for miRNA processing. drb1_arath Double-stranded RNA-binding protein 1 F21M12.9 At1g09700 DRB1 HYL1 Protein HYPONASTIC LEAVES 1 dsRNA-binding protein 1 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MTSTDVSSGVSNCYVFKSRLQEYAQKYKLPTPVYEIVKEGPSHKSLFQSTVILDGVRYNSLPGFFNRKAAEQSAAEVALRELAKSSELSQCVSQPVHETGLCKNLLQEYAQKMNYAIPLYQCQKVETLGRVTQFTCTVEIGGIKYTGAATRTKKDAEISAGRTALLAIQSDTKNNLANYNTQLTVLPCEKKTIQAAIPLKETVKTLKARKAQFKKKAQKGKRTVAKNPEDIIIPPQPTDHCQNDQSEKIETTPNLEPSSCMNGLKEAAFGSVETEKIETTPNLEPPSCMNGLKEAAFGSVETEKIETTPNLEPPSCMNGLKEAAFGSVETEKIETTPNLEPSSCMNGLKEAAFGSVETEKIETTPNLEPPSCMNGLKEAAFGSVETEKIETTPNLESSSCMSGLKEAAFGSVETEASHA DIP protein O04492 original sequence version: 65 FDBE165679537DFB srrt_arath Serrate RNA effector molecule SE T20P8.15 At2g27100 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MADVNLPPSDSVDNRLPEKSTSSSPPPPPPSSSLPQQEQEQDQQQLPLRRERDSRERRDERDIERPPPNRRERDRSPLPPPRRDYKRRPSLSPPPPYRDRRHSPPQRRSPPQKRYRRDDNGYDGRRGSPRGGYGPPDRRFGYDHGGGYDREMGGRPGYGDERPHGRFMGRYQDWEGGRGGYGDASNSGNPQRDGLMSYKQFIQELEDDILPSEAERRYQEYKSEYITTQKRAFFNTHKEEDWLKNKYHPTNLLSVIERRNDLAQKVAKDFLLDLQSGTLDLGPAVTALNKSGRTSEPNSEDEAAGVGKRKRHGMGGAKENELLSAAPKAPSFTSDPKRILTDVEQTQALVRKLDSEKKIEENVLQGSETEKSGREKLHSGSTGPVVIIRGLTSVKGLEGVELLDTLVTYLWRVHGLDYYGKVETNEAKGLRHVRAEGKVSDAKGDENESKFDSHWQERLKGQDPLEVMAAKEKIDAAATEALDPHVRKIRDEKYGWKYGCGAKGCTKLFHAAEFVYKHLKLKHTELVTELTTKVREELYFQNYMNDPNAPGGQPATQQSGPRDRPIRRKPSMENRLRDDRGGRRERDGRANGNDRNDRSEDQQRGDNDGGNPGEVGYDAFGGQGGVHVPPFLSDINPPPMLMPVPGAGPLGPFVPAPPEVAMQMFRDPSGPNPPFEGSGRGGPAPFLLSPAFRQDPRRLRSYQDLDAPEEEVTVIDYRSL DIP protein Q9ZVD0 original sequence version: 81 44D7041FAEA4A857 drb1-1 2 6 unspecified role unspecified role unspecified role unspecified role RBD2 Region 100-172 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction drb1-drb1-1 4 6 unspecified role unspecified role bait bait RBD1-2 Region 15-172 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress 6 unspecified role unspecified role prey prey arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress physical association physical association drb1-2 5 6 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction drb1-drb1-2 3 6 unspecified role unspecified role prey prey RBD2 Region 100-172 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 6 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli direct interaction direct interaction se-drb1-1 1 7 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress 6 unspecified role unspecified role prey prey arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress physical association physical association